CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease.
IFN-γ-producing CD4 T cells are required for protection against Mycobacterium tuberculosis (Mtb) infection, but the extent to which IFN-γ contributes to overall CD4 T cell-mediated protection remains unclear. Furthermore, it is not known if increasing IFN-γ production by CD4 T cells is desirable in...
| Main Authors: | , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Public Library of Science (PLoS)
2016-05-01
|
| Series: | PLoS Pathogens |
| Online Access: | https://journals.plos.org/plospathogens/article/file?id=10.1371/journal.ppat.1005667&type=printable |
| _version_ | 1826580842660495360 |
|---|---|
| author | Shunsuke Sakai Keith D Kauffman Michelle A Sallin Arlene H Sharpe Howard A Young Vitaly V Ganusov Daniel L Barber |
| author_facet | Shunsuke Sakai Keith D Kauffman Michelle A Sallin Arlene H Sharpe Howard A Young Vitaly V Ganusov Daniel L Barber |
| author_sort | Shunsuke Sakai |
| collection | DOAJ |
| description | IFN-γ-producing CD4 T cells are required for protection against Mycobacterium tuberculosis (Mtb) infection, but the extent to which IFN-γ contributes to overall CD4 T cell-mediated protection remains unclear. Furthermore, it is not known if increasing IFN-γ production by CD4 T cells is desirable in Mtb infection. Here we show that IFN-γ accounts for only ~30% of CD4 T cell-dependent cumulative bacterial control in the lungs over the first six weeks of infection, but >80% of control in the spleen. Moreover, increasing the IFN-γ-producing capacity of CD4 T cells by ~2 fold exacerbates lung infection and leads to the early death of the host, despite enhancing control in the spleen. In addition, we show that the inhibitory receptor PD-1 facilitates host resistance to Mtb by preventing the detrimental over-production of IFN-γ by CD4 T cells. Specifically, PD-1 suppressed the parenchymal accumulation of and pathogenic IFN-γ production by the CXCR3+KLRG1-CX3CR1- subset of lung-homing CD4 T cells that otherwise mediates control of Mtb infection. Therefore, the primary role for T cell-derived IFN-γ in Mtb infection is at extra-pulmonary sites, and the host-protective subset of CD4 T cells requires negative regulation of IFN-γ production by PD-1 to prevent lethal immune-mediated pathology. |
| first_indexed | 2024-12-19T20:07:23Z |
| format | Article |
| id | doaj.art-7f77a02e79c44c3fbea7435cc5c4fc21 |
| institution | Directory Open Access Journal |
| issn | 1553-7366 1553-7374 |
| language | English |
| last_indexed | 2025-03-14T14:40:36Z |
| publishDate | 2016-05-01 |
| publisher | Public Library of Science (PLoS) |
| record_format | Article |
| series | PLoS Pathogens |
| spelling | doaj.art-7f77a02e79c44c3fbea7435cc5c4fc212025-02-26T05:31:37ZengPublic Library of Science (PLoS)PLoS Pathogens1553-73661553-73742016-05-01125e100566710.1371/journal.ppat.1005667CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease.Shunsuke SakaiKeith D KauffmanMichelle A SallinArlene H SharpeHoward A YoungVitaly V GanusovDaniel L BarberIFN-γ-producing CD4 T cells are required for protection against Mycobacterium tuberculosis (Mtb) infection, but the extent to which IFN-γ contributes to overall CD4 T cell-mediated protection remains unclear. Furthermore, it is not known if increasing IFN-γ production by CD4 T cells is desirable in Mtb infection. Here we show that IFN-γ accounts for only ~30% of CD4 T cell-dependent cumulative bacterial control in the lungs over the first six weeks of infection, but >80% of control in the spleen. Moreover, increasing the IFN-γ-producing capacity of CD4 T cells by ~2 fold exacerbates lung infection and leads to the early death of the host, despite enhancing control in the spleen. In addition, we show that the inhibitory receptor PD-1 facilitates host resistance to Mtb by preventing the detrimental over-production of IFN-γ by CD4 T cells. Specifically, PD-1 suppressed the parenchymal accumulation of and pathogenic IFN-γ production by the CXCR3+KLRG1-CX3CR1- subset of lung-homing CD4 T cells that otherwise mediates control of Mtb infection. Therefore, the primary role for T cell-derived IFN-γ in Mtb infection is at extra-pulmonary sites, and the host-protective subset of CD4 T cells requires negative regulation of IFN-γ production by PD-1 to prevent lethal immune-mediated pathology.https://journals.plos.org/plospathogens/article/file?id=10.1371/journal.ppat.1005667&type=printable |
| spellingShingle | Shunsuke Sakai Keith D Kauffman Michelle A Sallin Arlene H Sharpe Howard A Young Vitaly V Ganusov Daniel L Barber CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease. PLoS Pathogens |
| title | CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease. |
| title_full | CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease. |
| title_fullStr | CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease. |
| title_full_unstemmed | CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease. |
| title_short | CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease. |
| title_sort | cd4 t cell derived ifn γ plays a minimal role in control of pulmonary mycobacterium tuberculosis infection and must be actively repressed by pd 1 to prevent lethal disease |
| url | https://journals.plos.org/plospathogens/article/file?id=10.1371/journal.ppat.1005667&type=printable |
| work_keys_str_mv | AT shunsukesakai cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease AT keithdkauffman cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease AT michelleasallin cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease AT arlenehsharpe cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease AT howardayoung cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease AT vitalyvganusov cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease AT daniellbarber cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease |