Preventive effect and mechanism of Tibetan tea extract on thrombosis in arachidonic acid-induced zebrafish determined via RNA-seq transcriptome profiles.
Thrombosis is a key pathological event in cardiovascular diseases and is also the most important targeting process for their clinical management. In this study, arachidonic acid (AA) was used to induce thrombus formation in zebrafish larvae. Blood flow, red blood cell (RBCs) aggregation and cellular...
| Main Authors: | , , , , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Public Library of Science (PLoS)
2023-01-01
|
| Series: | PLoS ONE |
| Online Access: | https://doi.org/10.1371/journal.pone.0285216 |
| _version_ | 1797805701714673664 |
|---|---|
| author | Ning Wang Chaohua Lan Huiqiang Lu Linman Li Dalong Liao Kewei Xu Haiyan Sun Yongqing Tang Yumeng Wang Jie Mei Mengting Wei Tao Wu Hui Zhu |
| author_facet | Ning Wang Chaohua Lan Huiqiang Lu Linman Li Dalong Liao Kewei Xu Haiyan Sun Yongqing Tang Yumeng Wang Jie Mei Mengting Wei Tao Wu Hui Zhu |
| author_sort | Ning Wang |
| collection | DOAJ |
| description | Thrombosis is a key pathological event in cardiovascular diseases and is also the most important targeting process for their clinical management. In this study, arachidonic acid (AA) was used to induce thrombus formation in zebrafish larvae. Blood flow, red blood cell (RBCs) aggregation and cellular oxidative stress were measured to evaluate the antithrombotic effect of Tibetan tea (TT). Meanwhile, the potential molecular mechanism was further explored by transcriptome sequencing (RNA-seq). The results indicated that TT could significantly restore heart RBCs intensity of thrombotic zebrafish, whilst decreasing RBCs accumulation in the caudal vein. The transcriptome analysis revealed that the preventive effect of TT on thrombosis could be mostly attributed to changes in lipid metabolism related signaling pathways, such as fatty acid metabolism, glycerollipid metabolism, ECM-receptor interaction and steroid biosynthesis signaling pathway. This study demonstrated that Tibetan tea could alleviate thrombosis by reducing oxidative stress levels and regulating lipid metabolism. |
| first_indexed | 2024-03-13T05:56:03Z |
| format | Article |
| id | doaj.art-7fd2cfa0ad174193a04c0243debd41e1 |
| institution | Directory Open Access Journal |
| issn | 1932-6203 |
| language | English |
| last_indexed | 2024-03-13T05:56:03Z |
| publishDate | 2023-01-01 |
| publisher | Public Library of Science (PLoS) |
| record_format | Article |
| series | PLoS ONE |
| spelling | doaj.art-7fd2cfa0ad174193a04c0243debd41e12023-06-13T05:31:30ZengPublic Library of Science (PLoS)PLoS ONE1932-62032023-01-01185e028521610.1371/journal.pone.0285216Preventive effect and mechanism of Tibetan tea extract on thrombosis in arachidonic acid-induced zebrafish determined via RNA-seq transcriptome profiles.Ning WangChaohua LanHuiqiang LuLinman LiDalong LiaoKewei XuHaiyan SunYongqing TangYumeng WangJie MeiMengting WeiTao WuHui ZhuThrombosis is a key pathological event in cardiovascular diseases and is also the most important targeting process for their clinical management. In this study, arachidonic acid (AA) was used to induce thrombus formation in zebrafish larvae. Blood flow, red blood cell (RBCs) aggregation and cellular oxidative stress were measured to evaluate the antithrombotic effect of Tibetan tea (TT). Meanwhile, the potential molecular mechanism was further explored by transcriptome sequencing (RNA-seq). The results indicated that TT could significantly restore heart RBCs intensity of thrombotic zebrafish, whilst decreasing RBCs accumulation in the caudal vein. The transcriptome analysis revealed that the preventive effect of TT on thrombosis could be mostly attributed to changes in lipid metabolism related signaling pathways, such as fatty acid metabolism, glycerollipid metabolism, ECM-receptor interaction and steroid biosynthesis signaling pathway. This study demonstrated that Tibetan tea could alleviate thrombosis by reducing oxidative stress levels and regulating lipid metabolism.https://doi.org/10.1371/journal.pone.0285216 |
| spellingShingle | Ning Wang Chaohua Lan Huiqiang Lu Linman Li Dalong Liao Kewei Xu Haiyan Sun Yongqing Tang Yumeng Wang Jie Mei Mengting Wei Tao Wu Hui Zhu Preventive effect and mechanism of Tibetan tea extract on thrombosis in arachidonic acid-induced zebrafish determined via RNA-seq transcriptome profiles. PLoS ONE |
| title | Preventive effect and mechanism of Tibetan tea extract on thrombosis in arachidonic acid-induced zebrafish determined via RNA-seq transcriptome profiles. |
| title_full | Preventive effect and mechanism of Tibetan tea extract on thrombosis in arachidonic acid-induced zebrafish determined via RNA-seq transcriptome profiles. |
| title_fullStr | Preventive effect and mechanism of Tibetan tea extract on thrombosis in arachidonic acid-induced zebrafish determined via RNA-seq transcriptome profiles. |
| title_full_unstemmed | Preventive effect and mechanism of Tibetan tea extract on thrombosis in arachidonic acid-induced zebrafish determined via RNA-seq transcriptome profiles. |
| title_short | Preventive effect and mechanism of Tibetan tea extract on thrombosis in arachidonic acid-induced zebrafish determined via RNA-seq transcriptome profiles. |
| title_sort | preventive effect and mechanism of tibetan tea extract on thrombosis in arachidonic acid induced zebrafish determined via rna seq transcriptome profiles |
| url | https://doi.org/10.1371/journal.pone.0285216 |
| work_keys_str_mv | AT ningwang preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles AT chaohualan preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles AT huiqianglu preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles AT linmanli preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles AT dalongliao preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles AT keweixu preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles AT haiyansun preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles AT yongqingtang preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles AT yumengwang preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles AT jiemei preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles AT mengtingwei preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles AT taowu preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles AT huizhu preventiveeffectandmechanismoftibetanteaextractonthrombosisinarachidonicacidinducedzebrafishdeterminedviarnaseqtranscriptomeprofiles |