The JAK/STAT Pathway and Its Selective Inhibition in the Treatment of Atopic Dermatitis: A Systematic Review
In recent years, the broadening understanding of the pathogenesis of atopic dermatitis (AD) has led to the development of novel therapeutic molecules, that target core inflammatory components of the disease. The Janus kinase (JAK)/signal transducer and activation of transcription (STAT) pathway cons...
| Main Authors: | , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2022-07-01
|
| Series: | Journal of Clinical Medicine |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2077-0383/11/15/4431 |
| _version_ | 1797441692785180672 |
|---|---|
| author | Aikaterini Tsiogka Maria Kyriazopoulou George Kontochristopoulos Electra Nicolaidou Alexander Stratigos Dimitris Rigopoulos Stamatios Gregoriou |
| author_facet | Aikaterini Tsiogka Maria Kyriazopoulou George Kontochristopoulos Electra Nicolaidou Alexander Stratigos Dimitris Rigopoulos Stamatios Gregoriou |
| author_sort | Aikaterini Tsiogka |
| collection | DOAJ |
| description | In recent years, the broadening understanding of the pathogenesis of atopic dermatitis (AD) has led to the development of novel therapeutic molecules, that target core inflammatory components of the disease. The Janus kinase (JAK)/signal transducer and activation of transcription (STAT) pathway constitutes the principal signaling cascade for a large number of cytokines and growth factors and is involved in intracellular signal transduction and subsequent regulation of gene transcription. Current knowledge suggests that the robust activation of the T-helper (Th)-2 [interleukin (IL)-4, IL-5, IL-13, IL-31] and Th22 (IL-22) immune responses in both skin and serum plays a pivotal role in the immunopathogenesis of AD especially at the acute stage, followed by a variable degree of Th1 (interferon-γ, tumor necrosis factor alpha) and Th17 (IL-17) activation in chronic disease. Of note, most of the aforementioned inflammatory cytokines utilize the JAK/STAT pathway for downstream signal transduction, explaining the emerging role of JAK inhibitors in the therapeutic armamentarium of AD. The present systematic review aims to discuss the involvement of JAK/STAT pathway in the pathogenesis of AD and summarize the clinical data available on the efficacy and safety of JAK inhibitors which have been used in the treatment of AD thus far. |
| first_indexed | 2024-03-09T12:27:49Z |
| format | Article |
| id | doaj.art-853e76b7bf7942bba01ebab4b160b226 |
| institution | Directory Open Access Journal |
| issn | 2077-0383 |
| language | English |
| last_indexed | 2024-03-09T12:27:49Z |
| publishDate | 2022-07-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Journal of Clinical Medicine |
| spelling | doaj.art-853e76b7bf7942bba01ebab4b160b2262023-11-30T22:33:04ZengMDPI AGJournal of Clinical Medicine2077-03832022-07-011115443110.3390/jcm11154431The JAK/STAT Pathway and Its Selective Inhibition in the Treatment of Atopic Dermatitis: A Systematic ReviewAikaterini Tsiogka0Maria Kyriazopoulou1George Kontochristopoulos2Electra Nicolaidou3Alexander Stratigos4Dimitris Rigopoulos5Stamatios Gregoriou61st Department of Dermatology-Venereology, Faculty of Medicine, Andreas Sygros Hospital, National and Kapodistrian University of Athens, 16121 Athens, Greece1st Department of Dermatology-Venereology, Faculty of Medicine, Andreas Sygros Hospital, National and Kapodistrian University of Athens, 16121 Athens, Greece1st Department of Dermatology-Venereology, Faculty of Medicine, Andreas Sygros Hospital, National and Kapodistrian University of Athens, 16121 Athens, Greece1st Department of Dermatology-Venereology, Faculty of Medicine, Andreas Sygros Hospital, National and Kapodistrian University of Athens, 16121 Athens, Greece1st Department of Dermatology-Venereology, Faculty of Medicine, Andreas Sygros Hospital, National and Kapodistrian University of Athens, 16121 Athens, Greece1st Department of Dermatology-Venereology, Faculty of Medicine, Andreas Sygros Hospital, National and Kapodistrian University of Athens, 16121 Athens, Greece1st Department of Dermatology-Venereology, Faculty of Medicine, Andreas Sygros Hospital, National and Kapodistrian University of Athens, 16121 Athens, GreeceIn recent years, the broadening understanding of the pathogenesis of atopic dermatitis (AD) has led to the development of novel therapeutic molecules, that target core inflammatory components of the disease. The Janus kinase (JAK)/signal transducer and activation of transcription (STAT) pathway constitutes the principal signaling cascade for a large number of cytokines and growth factors and is involved in intracellular signal transduction and subsequent regulation of gene transcription. Current knowledge suggests that the robust activation of the T-helper (Th)-2 [interleukin (IL)-4, IL-5, IL-13, IL-31] and Th22 (IL-22) immune responses in both skin and serum plays a pivotal role in the immunopathogenesis of AD especially at the acute stage, followed by a variable degree of Th1 (interferon-γ, tumor necrosis factor alpha) and Th17 (IL-17) activation in chronic disease. Of note, most of the aforementioned inflammatory cytokines utilize the JAK/STAT pathway for downstream signal transduction, explaining the emerging role of JAK inhibitors in the therapeutic armamentarium of AD. The present systematic review aims to discuss the involvement of JAK/STAT pathway in the pathogenesis of AD and summarize the clinical data available on the efficacy and safety of JAK inhibitors which have been used in the treatment of AD thus far.https://www.mdpi.com/2077-0383/11/15/4431atopic dermatitisJAK/STAT pathwaytreatmentJAK inhibitorTh2 immune responseJanus kinase |
| spellingShingle | Aikaterini Tsiogka Maria Kyriazopoulou George Kontochristopoulos Electra Nicolaidou Alexander Stratigos Dimitris Rigopoulos Stamatios Gregoriou The JAK/STAT Pathway and Its Selective Inhibition in the Treatment of Atopic Dermatitis: A Systematic Review Journal of Clinical Medicine atopic dermatitis JAK/STAT pathway treatment JAK inhibitor Th2 immune response Janus kinase |
| title | The JAK/STAT Pathway and Its Selective Inhibition in the Treatment of Atopic Dermatitis: A Systematic Review |
| title_full | The JAK/STAT Pathway and Its Selective Inhibition in the Treatment of Atopic Dermatitis: A Systematic Review |
| title_fullStr | The JAK/STAT Pathway and Its Selective Inhibition in the Treatment of Atopic Dermatitis: A Systematic Review |
| title_full_unstemmed | The JAK/STAT Pathway and Its Selective Inhibition in the Treatment of Atopic Dermatitis: A Systematic Review |
| title_short | The JAK/STAT Pathway and Its Selective Inhibition in the Treatment of Atopic Dermatitis: A Systematic Review |
| title_sort | jak stat pathway and its selective inhibition in the treatment of atopic dermatitis a systematic review |
| topic | atopic dermatitis JAK/STAT pathway treatment JAK inhibitor Th2 immune response Janus kinase |
| url | https://www.mdpi.com/2077-0383/11/15/4431 |
| work_keys_str_mv | AT aikaterinitsiogka thejakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT mariakyriazopoulou thejakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT georgekontochristopoulos thejakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT electranicolaidou thejakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT alexanderstratigos thejakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT dimitrisrigopoulos thejakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT stamatiosgregoriou thejakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT aikaterinitsiogka jakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT mariakyriazopoulou jakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT georgekontochristopoulos jakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT electranicolaidou jakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT alexanderstratigos jakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT dimitrisrigopoulos jakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview AT stamatiosgregoriou jakstatpathwayanditsselectiveinhibitioninthetreatmentofatopicdermatitisasystematicreview |