Recombinant L. lactis vaccine LL-plSAM-WAE targeting four virulence factors provides mucosal immunity against H. pylori infection
Abstract Background Helicobacter pylori (H. pylori) causes chronic gastric disease. An efficient oral vaccine would be mucosa-targeted and offer defense against colonization of invasive infection in the digestive system. Proteolytic enzymes and acidic environment in the gastrointestinal tract (GT) c...
| Main Authors: | , , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
BMC
2024-02-01
|
| Series: | Microbial Cell Factories |
| Subjects: | |
| Online Access: | https://doi.org/10.1186/s12934-024-02321-4 |
| _version_ | 1827325311507759104 |
|---|---|
| author | Furui Zhang Linhan Ni Zhen Zhang Xuegang Luo Xuequan Wang Wenmiao Zhou Jiale Chen Jing Liu Yuliang Qu Kunmei Liu Le Guo |
| author_facet | Furui Zhang Linhan Ni Zhen Zhang Xuegang Luo Xuequan Wang Wenmiao Zhou Jiale Chen Jing Liu Yuliang Qu Kunmei Liu Le Guo |
| author_sort | Furui Zhang |
| collection | DOAJ |
| description | Abstract Background Helicobacter pylori (H. pylori) causes chronic gastric disease. An efficient oral vaccine would be mucosa-targeted and offer defense against colonization of invasive infection in the digestive system. Proteolytic enzymes and acidic environment in the gastrointestinal tract (GT) can, however, reduce the effectiveness of oral vaccinations. For the creation of an edible vaccine, L. lactis has been proposed as a means of delivering vaccine antigens. Results We developed a plSAM (pNZ8148-SAM) that expresses a multiepitope vaccine antigen SAM-WAE containing Urease, HpaA, HSP60, and NAP extracellularly (named LL-plSAM-WAE) to increase the efficacy of oral vaccinations. We then investigated the immunogenicity of LL-plSAM-WAE in Balb/c mice. Mice that received LL-plSAM-WAE or SAM-WAE with adjuvant showed increased levels of antibodies against H. pylori, including IgG and sIgA, and resulted in significant reductions in H. pylori colonization. Furthermore, we show that SAM-WAE and LL-plSAM-WAE improved the capacity to target the vaccine to M cells. Conclusions These findings suggest that recombinant L. lactis could be a promising oral mucosa vaccination for preventing H. pylori infection. |
| first_indexed | 2024-03-07T14:25:18Z |
| format | Article |
| id | doaj.art-86fe6f133ca240efbc904fc4c56f406a |
| institution | Directory Open Access Journal |
| issn | 1475-2859 |
| language | English |
| last_indexed | 2024-03-07T14:25:18Z |
| publishDate | 2024-02-01 |
| publisher | BMC |
| record_format | Article |
| series | Microbial Cell Factories |
| spelling | doaj.art-86fe6f133ca240efbc904fc4c56f406a2024-03-06T08:06:38ZengBMCMicrobial Cell Factories1475-28592024-02-0123111510.1186/s12934-024-02321-4Recombinant L. lactis vaccine LL-plSAM-WAE targeting four virulence factors provides mucosal immunity against H. pylori infectionFurui Zhang0Linhan Ni1Zhen Zhang2Xuegang Luo3Xuequan Wang4Wenmiao Zhou5Jiale Chen6Jing Liu7Yuliang Qu8Kunmei Liu9Le Guo10College of First Clinical Medicine, Ningxia Medical UniversityCollege of Pharmacy, Ningxia Medical UniversityDepartment of Geriatrics and Special Needs Medicine, General Hospital of Ningxia Medical UniversityKey Laboratory of Industrial Fermentation Microbiology of the Ministry of Education, College of Biotechnology, Tianjin University of Science and TechnologyKey Laboratory of Radiation Oncology of Taizhou, Taizhou Hospital of Zhejiang Province affiliated to Wenzhou Medical UniversityCollege of First Clinical Medicine, Ningxia Medical UniversityCollege of First Clinical Medicine, Ningxia Medical UniversityCollege of Laboratory Medicine , Ningxia Medical UniversityCollege of Laboratory Medicine , Ningxia Medical UniversityCollege of Pharmacy, Ningxia Medical UniversityCollege of First Clinical Medicine, Ningxia Medical UniversityAbstract Background Helicobacter pylori (H. pylori) causes chronic gastric disease. An efficient oral vaccine would be mucosa-targeted and offer defense against colonization of invasive infection in the digestive system. Proteolytic enzymes and acidic environment in the gastrointestinal tract (GT) can, however, reduce the effectiveness of oral vaccinations. For the creation of an edible vaccine, L. lactis has been proposed as a means of delivering vaccine antigens. Results We developed a plSAM (pNZ8148-SAM) that expresses a multiepitope vaccine antigen SAM-WAE containing Urease, HpaA, HSP60, and NAP extracellularly (named LL-plSAM-WAE) to increase the efficacy of oral vaccinations. We then investigated the immunogenicity of LL-plSAM-WAE in Balb/c mice. Mice that received LL-plSAM-WAE or SAM-WAE with adjuvant showed increased levels of antibodies against H. pylori, including IgG and sIgA, and resulted in significant reductions in H. pylori colonization. Furthermore, we show that SAM-WAE and LL-plSAM-WAE improved the capacity to target the vaccine to M cells. Conclusions These findings suggest that recombinant L. lactis could be a promising oral mucosa vaccination for preventing H. pylori infection.https://doi.org/10.1186/s12934-024-02321-4Helicobacter pyloriLactic acid bacteriaM cell-targetingVaccine delivery systemMucosal immune response |
| spellingShingle | Furui Zhang Linhan Ni Zhen Zhang Xuegang Luo Xuequan Wang Wenmiao Zhou Jiale Chen Jing Liu Yuliang Qu Kunmei Liu Le Guo Recombinant L. lactis vaccine LL-plSAM-WAE targeting four virulence factors provides mucosal immunity against H. pylori infection Microbial Cell Factories Helicobacter pylori Lactic acid bacteria M cell-targeting Vaccine delivery system Mucosal immune response |
| title | Recombinant L. lactis vaccine LL-plSAM-WAE targeting four virulence factors provides mucosal immunity against H. pylori infection |
| title_full | Recombinant L. lactis vaccine LL-plSAM-WAE targeting four virulence factors provides mucosal immunity against H. pylori infection |
| title_fullStr | Recombinant L. lactis vaccine LL-plSAM-WAE targeting four virulence factors provides mucosal immunity against H. pylori infection |
| title_full_unstemmed | Recombinant L. lactis vaccine LL-plSAM-WAE targeting four virulence factors provides mucosal immunity against H. pylori infection |
| title_short | Recombinant L. lactis vaccine LL-plSAM-WAE targeting four virulence factors provides mucosal immunity against H. pylori infection |
| title_sort | recombinant l lactis vaccine ll plsam wae targeting four virulence factors provides mucosal immunity against h pylori infection |
| topic | Helicobacter pylori Lactic acid bacteria M cell-targeting Vaccine delivery system Mucosal immune response |
| url | https://doi.org/10.1186/s12934-024-02321-4 |
| work_keys_str_mv | AT furuizhang recombinantllactisvaccinellplsamwaetargetingfourvirulencefactorsprovidesmucosalimmunityagainsthpyloriinfection AT linhanni recombinantllactisvaccinellplsamwaetargetingfourvirulencefactorsprovidesmucosalimmunityagainsthpyloriinfection AT zhenzhang recombinantllactisvaccinellplsamwaetargetingfourvirulencefactorsprovidesmucosalimmunityagainsthpyloriinfection AT xuegangluo recombinantllactisvaccinellplsamwaetargetingfourvirulencefactorsprovidesmucosalimmunityagainsthpyloriinfection AT xuequanwang recombinantllactisvaccinellplsamwaetargetingfourvirulencefactorsprovidesmucosalimmunityagainsthpyloriinfection AT wenmiaozhou recombinantllactisvaccinellplsamwaetargetingfourvirulencefactorsprovidesmucosalimmunityagainsthpyloriinfection AT jialechen recombinantllactisvaccinellplsamwaetargetingfourvirulencefactorsprovidesmucosalimmunityagainsthpyloriinfection AT jingliu recombinantllactisvaccinellplsamwaetargetingfourvirulencefactorsprovidesmucosalimmunityagainsthpyloriinfection AT yuliangqu recombinantllactisvaccinellplsamwaetargetingfourvirulencefactorsprovidesmucosalimmunityagainsthpyloriinfection AT kunmeiliu recombinantllactisvaccinellplsamwaetargetingfourvirulencefactorsprovidesmucosalimmunityagainsthpyloriinfection AT leguo recombinantllactisvaccinellplsamwaetargetingfourvirulencefactorsprovidesmucosalimmunityagainsthpyloriinfection |