Experimental Study and Simulation of Iraqi Heavy Naphtha Catalytic Reforming Reactions Using Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3 Catalysts
In present study experimental and mathematical model have been carried out to describe the reaction kinetics of catalytic reforming process using Iraqi heavy naphtha as a feedstock for the process. Two types of catalysts were prepared (Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3) supported on γ-AL2O3. The main t...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Unviversity of Technology- Iraq
2013-10-01
|
| Series: | Engineering and Technology Journal |
| Subjects: | |
| Online Access: | https://etj.uotechnology.edu.iq/article_83693_180ae6eed6672f5b127d84346827a9b4.pdf |
| _version_ | 1827358487977394176 |
|---|---|
| author | Ramzy S. Hamied Shahrazad R. Raouf Khalid A. Sukkar |
| author_facet | Ramzy S. Hamied Shahrazad R. Raouf Khalid A. Sukkar |
| author_sort | Ramzy S. Hamied |
| collection | DOAJ |
| description | In present study experimental and mathematical model have been carried out to describe the reaction kinetics of catalytic reforming process using Iraqi heavy naphtha as a feedstock for the process. Two types of catalysts were prepared (Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3) supported on γ-AL2O3. The main three described reforming reactions were investigated (dehydrogenation, hydrocracking, and dehydrocyclization) to characterize catalysts performance in term of activity and selectivity. The performance of catalysts were investigated under the following operating condition: reaction temperature range of 480-510 ˚C, weight hour space velocity range of 1-2hr-1, pressure at 6 atm, and hydrogen to hydrocarbon ratio of 4:1.The results show higher conversion of Iraqi heavy naphtha components (i.e., Paraffins and Naphthenes) with higher temperatures whereas; weight hourly space velocity has shown negative impact on conversion (i.e., higher WHSV shows lower conversion). In general, it was noted that the yields of aromatics and light components are increased for both types of catalysts (Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3) under the same operating conditions. Results of tri-metal catalyst better than bi-metal catalyst. A comprehensive mathematical model and simulation was developed in the present work to describe the reaction kinetics of reforming reactions. The model predicts the concentration, conversion, and temperature profile with time and axial direction of the reactor. The comparison between experimental and simulation results of the concentrations of (Paraffin’s, Naphthenes, and Aromatics), and temperature showed a good agreement with a deviation confined 19.50%. |
| first_indexed | 2024-03-08T06:11:31Z |
| format | Article |
| id | doaj.art-87e03ee50323415183e042da43801003 |
| institution | Directory Open Access Journal |
| issn | 1681-6900 2412-0758 |
| language | English |
| last_indexed | 2024-03-08T06:11:31Z |
| publishDate | 2013-10-01 |
| publisher | Unviversity of Technology- Iraq |
| record_format | Article |
| series | Engineering and Technology Journal |
| spelling | doaj.art-87e03ee50323415183e042da438010032024-02-04T17:36:44ZengUnviversity of Technology- IraqEngineering and Technology Journal1681-69002412-07582013-10-013118143510.30684/etj.2013.8369383693Experimental Study and Simulation of Iraqi Heavy Naphtha Catalytic Reforming Reactions Using Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3 CatalystsRamzy S. HamiedShahrazad R. RaoufKhalid A. SukkarIn present study experimental and mathematical model have been carried out to describe the reaction kinetics of catalytic reforming process using Iraqi heavy naphtha as a feedstock for the process. Two types of catalysts were prepared (Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3) supported on γ-AL2O3. The main three described reforming reactions were investigated (dehydrogenation, hydrocracking, and dehydrocyclization) to characterize catalysts performance in term of activity and selectivity. The performance of catalysts were investigated under the following operating condition: reaction temperature range of 480-510 ˚C, weight hour space velocity range of 1-2hr-1, pressure at 6 atm, and hydrogen to hydrocarbon ratio of 4:1.The results show higher conversion of Iraqi heavy naphtha components (i.e., Paraffins and Naphthenes) with higher temperatures whereas; weight hourly space velocity has shown negative impact on conversion (i.e., higher WHSV shows lower conversion). In general, it was noted that the yields of aromatics and light components are increased for both types of catalysts (Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3) under the same operating conditions. Results of tri-metal catalyst better than bi-metal catalyst. A comprehensive mathematical model and simulation was developed in the present work to describe the reaction kinetics of reforming reactions. The model predicts the concentration, conversion, and temperature profile with time and axial direction of the reactor. The comparison between experimental and simulation results of the concentrations of (Paraffin’s, Naphthenes, and Aromatics), and temperature showed a good agreement with a deviation confined 19.50%.https://etj.uotechnology.edu.iq/article_83693_180ae6eed6672f5b127d84346827a9b4.pdfsimulationmathematical modelcatalytic reformingheavy naphthareformingand pt |
| spellingShingle | Ramzy S. Hamied Shahrazad R. Raouf Khalid A. Sukkar Experimental Study and Simulation of Iraqi Heavy Naphtha Catalytic Reforming Reactions Using Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3 Catalysts Engineering and Technology Journal simulation mathematical model catalytic reforming heavy naphtha reforming and pt |
| title | Experimental Study and Simulation of Iraqi Heavy Naphtha Catalytic Reforming Reactions Using Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3 Catalysts |
| title_full | Experimental Study and Simulation of Iraqi Heavy Naphtha Catalytic Reforming Reactions Using Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3 Catalysts |
| title_fullStr | Experimental Study and Simulation of Iraqi Heavy Naphtha Catalytic Reforming Reactions Using Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3 Catalysts |
| title_full_unstemmed | Experimental Study and Simulation of Iraqi Heavy Naphtha Catalytic Reforming Reactions Using Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3 Catalysts |
| title_short | Experimental Study and Simulation of Iraqi Heavy Naphtha Catalytic Reforming Reactions Using Pt-Ir-Sn/AL2O3 and Pt-Ir/AL2O3 Catalysts |
| title_sort | experimental study and simulation of iraqi heavy naphtha catalytic reforming reactions using pt ir sn al2o3 and pt ir al2o3 catalysts |
| topic | simulation mathematical model catalytic reforming heavy naphtha reforming and pt |
| url | https://etj.uotechnology.edu.iq/article_83693_180ae6eed6672f5b127d84346827a9b4.pdf |
| work_keys_str_mv | AT ramzyshamied experimentalstudyandsimulationofiraqiheavynaphthacatalyticreformingreactionsusingptirsnal2o3andptiral2o3catalysts AT shahrazadrraouf experimentalstudyandsimulationofiraqiheavynaphthacatalyticreformingreactionsusingptirsnal2o3andptiral2o3catalysts AT khalidasukkar experimentalstudyandsimulationofiraqiheavynaphthacatalyticreformingreactionsusingptirsnal2o3andptiral2o3catalysts |