CHK1 inhibition as a strategy for targeting fanconi anemia (FA) DNA repair pathway deficient tumors
<p>Abstract</p> <p>Background</p> <p>DNA repair deficient tumor cells have been shown to accumulate high levels of DNA damage. Consequently, these cells become hyper-dependent on DNA damage response pathways, including the CHK1-kinase-mediated response. These observatio...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
BMC
2009-04-01
|
| Series: | Molecular Cancer |
| Online Access: | http://www.molecular-cancer.com/content/8/1/24 |
| _version_ | 1818154545695424512 |
|---|---|
| author | Look A Thomas Sidi Samuel Kennedy Richard D Chen Clark C D'Andrea Alan |
| author_facet | Look A Thomas Sidi Samuel Kennedy Richard D Chen Clark C D'Andrea Alan |
| author_sort | Look A Thomas |
| collection | DOAJ |
| description | <p>Abstract</p> <p>Background</p> <p>DNA repair deficient tumor cells have been shown to accumulate high levels of DNA damage. Consequently, these cells become hyper-dependent on DNA damage response pathways, including the CHK1-kinase-mediated response. These observations suggest that DNA repair deficient tumors should exhibit increased sensitivity to CHK1 inhibition. Here we offer experimental evidence in support of this hypothesis.</p> <p>Results</p> <p>Using isogenic pairs of cell lines differing only in the Fanconi Anemia (FA) DNA repair pathway, we showed that FA deficient cell lines were hypersensitive to <it>CHK1 </it>silencing by independent siRNAs as well as CHK1 pharmacologic inhibition by Gö6976 and UCN-01. In parallel, an siRNA screen designed to identify gene silencings synthetically lethal with CHK1 inhibition identified genes required for FA pathway function. To confirm these findings <it>in vivo</it>, we demonstrated that whole zebrafish embryos, depleted for <it>FANCD2 </it>by a morpholino approach, were hypersensitive to Gö6976. Silencing of FA genes led to hyper-activation of CHK1 and vice versa. Furthermore, inactivation of CHK1 in FA deficient cell lines caused increased accumulation of DNA strand and chromosomal breakages. These results suggest that the functions subserved by CHK1 and the FA pathway mutually compensate in maintaining genome integrity. As CHK1 inhibition has been under clinical trial in combination with cisplatin, we showed that the FA specific tumoricidal effect of CHK1 inhibition and cisplatin was synergistic.</p> <p>Conclusion</p> <p>Taken together, these results suggest CHK1 inhibition as a strategy for targeting FA deficient tumors.</p> |
| first_indexed | 2024-12-11T14:28:13Z |
| format | Article |
| id | doaj.art-88f58ad630cc4fefbd2013cc6c4ca4ba |
| institution | Directory Open Access Journal |
| issn | 1476-4598 |
| language | English |
| last_indexed | 2024-12-11T14:28:13Z |
| publishDate | 2009-04-01 |
| publisher | BMC |
| record_format | Article |
| series | Molecular Cancer |
| spelling | doaj.art-88f58ad630cc4fefbd2013cc6c4ca4ba2022-12-22T01:02:34ZengBMCMolecular Cancer1476-45982009-04-01812410.1186/1476-4598-8-24CHK1 inhibition as a strategy for targeting fanconi anemia (FA) DNA repair pathway deficient tumorsLook A ThomasSidi SamuelKennedy Richard DChen Clark CD'Andrea Alan<p>Abstract</p> <p>Background</p> <p>DNA repair deficient tumor cells have been shown to accumulate high levels of DNA damage. Consequently, these cells become hyper-dependent on DNA damage response pathways, including the CHK1-kinase-mediated response. These observations suggest that DNA repair deficient tumors should exhibit increased sensitivity to CHK1 inhibition. Here we offer experimental evidence in support of this hypothesis.</p> <p>Results</p> <p>Using isogenic pairs of cell lines differing only in the Fanconi Anemia (FA) DNA repair pathway, we showed that FA deficient cell lines were hypersensitive to <it>CHK1 </it>silencing by independent siRNAs as well as CHK1 pharmacologic inhibition by Gö6976 and UCN-01. In parallel, an siRNA screen designed to identify gene silencings synthetically lethal with CHK1 inhibition identified genes required for FA pathway function. To confirm these findings <it>in vivo</it>, we demonstrated that whole zebrafish embryos, depleted for <it>FANCD2 </it>by a morpholino approach, were hypersensitive to Gö6976. Silencing of FA genes led to hyper-activation of CHK1 and vice versa. Furthermore, inactivation of CHK1 in FA deficient cell lines caused increased accumulation of DNA strand and chromosomal breakages. These results suggest that the functions subserved by CHK1 and the FA pathway mutually compensate in maintaining genome integrity. As CHK1 inhibition has been under clinical trial in combination with cisplatin, we showed that the FA specific tumoricidal effect of CHK1 inhibition and cisplatin was synergistic.</p> <p>Conclusion</p> <p>Taken together, these results suggest CHK1 inhibition as a strategy for targeting FA deficient tumors.</p>http://www.molecular-cancer.com/content/8/1/24 |
| spellingShingle | Look A Thomas Sidi Samuel Kennedy Richard D Chen Clark C D'Andrea Alan CHK1 inhibition as a strategy for targeting fanconi anemia (FA) DNA repair pathway deficient tumors Molecular Cancer |
| title | CHK1 inhibition as a strategy for targeting fanconi anemia (FA) DNA repair pathway deficient tumors |
| title_full | CHK1 inhibition as a strategy for targeting fanconi anemia (FA) DNA repair pathway deficient tumors |
| title_fullStr | CHK1 inhibition as a strategy for targeting fanconi anemia (FA) DNA repair pathway deficient tumors |
| title_full_unstemmed | CHK1 inhibition as a strategy for targeting fanconi anemia (FA) DNA repair pathway deficient tumors |
| title_short | CHK1 inhibition as a strategy for targeting fanconi anemia (FA) DNA repair pathway deficient tumors |
| title_sort | chk1 inhibition as a strategy for targeting fanconi anemia fa dna repair pathway deficient tumors |
| url | http://www.molecular-cancer.com/content/8/1/24 |
| work_keys_str_mv | AT lookathomas chk1inhibitionasastrategyfortargetingfanconianemiafadnarepairpathwaydeficienttumors AT sidisamuel chk1inhibitionasastrategyfortargetingfanconianemiafadnarepairpathwaydeficienttumors AT kennedyrichardd chk1inhibitionasastrategyfortargetingfanconianemiafadnarepairpathwaydeficienttumors AT chenclarkc chk1inhibitionasastrategyfortargetingfanconianemiafadnarepairpathwaydeficienttumors AT dandreaalan chk1inhibitionasastrategyfortargetingfanconianemiafadnarepairpathwaydeficienttumors |