Proteomics analysis of faecal proteins in the tick Haemaphysalis flava
Abstract Background Ticks and tick-borne diseases are of major public health concern. Currently, development of vaccines against ticks is considered crucial for their control. A critical step in this process is the screening of viable antigens. Faeces are byproducts of digestion and blood meal utili...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
BMC
2018-02-01
|
| Series: | Parasites & Vectors |
| Subjects: | |
| Online Access: | http://link.springer.com/article/10.1186/s13071-018-2673-3 |
| _version_ | 1828377996711428096 |
|---|---|
| author | Lei Liu Yi-song Liu Guo-Hua Liu Tian-yin Cheng |
| author_facet | Lei Liu Yi-song Liu Guo-Hua Liu Tian-yin Cheng |
| author_sort | Lei Liu |
| collection | DOAJ |
| description | Abstract Background Ticks and tick-borne diseases are of major public health concern. Currently, development of vaccines against ticks is considered crucial for their control. A critical step in this process is the screening of viable antigens. Faeces are byproducts of digestion and blood meal utilization, and partly reflect the vitality and vector potential of ticks. However, an integrated analysis of proteins in tick faeces is lacking. The present study explored the protein components in the faeces of the tick Haemaphysalis flava, by liquid chromatography–tandem mass spectrometry (LC/MS-MS) to identify potential protein antigens for vaccine development against ticks. Methods Faeces from adult H. flava engorged females were collected. Proteins were extracted from faeces, and the trypsin-digested peptides were analyzed by LC/MS-MS. High confidence proteins were identified based on unique peptides revealed by MS. Potential faecal protein genes, as well as their sources, were also characterized by searching previous transcriptome datasets from the salivary glands and midgut of H. flava. Results In total, 21 were recognized with confidence. Amongst these, 18 were of likely tick origin, while three proteins (serum albumin, haemoglobin α and β subunits) were likely from hosts. Seventeen unigenes corresponding to these proteins were retrieved by searching our previous H. flava salivary glands and midgut transcriptomic datasets. Some proteins were reported to prevent blood clotting, play a role in immunity and antibiosis, and formation of musculature. The functions of the remaining proteins are unknown. Conclusions Identifying antigens for tick vaccine development is feasible by analyzing the faecal proteome as well as the transcriptomes of salivary glands and midguts. The vast number of proteins detected in tick faeces highlights the complexity of blood digestion in ticks, a field that needs more investigation. |
| first_indexed | 2024-04-14T08:20:14Z |
| format | Article |
| id | doaj.art-902acb13cd7a4f869c26a57ceed2348d |
| institution | Directory Open Access Journal |
| issn | 1756-3305 |
| language | English |
| last_indexed | 2024-04-14T08:20:14Z |
| publishDate | 2018-02-01 |
| publisher | BMC |
| record_format | Article |
| series | Parasites & Vectors |
| spelling | doaj.art-902acb13cd7a4f869c26a57ceed2348d2022-12-22T02:04:15ZengBMCParasites & Vectors1756-33052018-02-011111710.1186/s13071-018-2673-3Proteomics analysis of faecal proteins in the tick Haemaphysalis flavaLei Liu0Yi-song Liu1Guo-Hua Liu2Tian-yin Cheng3College of Veterinary Medicine, Hunan Collaborative Innovation Center of Safety Production of Livestock and Poultry, Hunan Agricultural UniversityCollege of Veterinary Medicine, Hunan Collaborative Innovation Center of Safety Production of Livestock and Poultry, Hunan Agricultural UniversityCollege of Veterinary Medicine, Hunan Collaborative Innovation Center of Safety Production of Livestock and Poultry, Hunan Agricultural UniversityCollege of Veterinary Medicine, Hunan Collaborative Innovation Center of Safety Production of Livestock and Poultry, Hunan Agricultural UniversityAbstract Background Ticks and tick-borne diseases are of major public health concern. Currently, development of vaccines against ticks is considered crucial for their control. A critical step in this process is the screening of viable antigens. Faeces are byproducts of digestion and blood meal utilization, and partly reflect the vitality and vector potential of ticks. However, an integrated analysis of proteins in tick faeces is lacking. The present study explored the protein components in the faeces of the tick Haemaphysalis flava, by liquid chromatography–tandem mass spectrometry (LC/MS-MS) to identify potential protein antigens for vaccine development against ticks. Methods Faeces from adult H. flava engorged females were collected. Proteins were extracted from faeces, and the trypsin-digested peptides were analyzed by LC/MS-MS. High confidence proteins were identified based on unique peptides revealed by MS. Potential faecal protein genes, as well as their sources, were also characterized by searching previous transcriptome datasets from the salivary glands and midgut of H. flava. Results In total, 21 were recognized with confidence. Amongst these, 18 were of likely tick origin, while three proteins (serum albumin, haemoglobin α and β subunits) were likely from hosts. Seventeen unigenes corresponding to these proteins were retrieved by searching our previous H. flava salivary glands and midgut transcriptomic datasets. Some proteins were reported to prevent blood clotting, play a role in immunity and antibiosis, and formation of musculature. The functions of the remaining proteins are unknown. Conclusions Identifying antigens for tick vaccine development is feasible by analyzing the faecal proteome as well as the transcriptomes of salivary glands and midguts. The vast number of proteins detected in tick faeces highlights the complexity of blood digestion in ticks, a field that needs more investigation.http://link.springer.com/article/10.1186/s13071-018-2673-3Haemaphysalis flavaTickFaecesProteomeBlood digestion |
| spellingShingle | Lei Liu Yi-song Liu Guo-Hua Liu Tian-yin Cheng Proteomics analysis of faecal proteins in the tick Haemaphysalis flava Parasites & Vectors Haemaphysalis flava Tick Faeces Proteome Blood digestion |
| title | Proteomics analysis of faecal proteins in the tick Haemaphysalis flava |
| title_full | Proteomics analysis of faecal proteins in the tick Haemaphysalis flava |
| title_fullStr | Proteomics analysis of faecal proteins in the tick Haemaphysalis flava |
| title_full_unstemmed | Proteomics analysis of faecal proteins in the tick Haemaphysalis flava |
| title_short | Proteomics analysis of faecal proteins in the tick Haemaphysalis flava |
| title_sort | proteomics analysis of faecal proteins in the tick haemaphysalis flava |
| topic | Haemaphysalis flava Tick Faeces Proteome Blood digestion |
| url | http://link.springer.com/article/10.1186/s13071-018-2673-3 |
| work_keys_str_mv | AT leiliu proteomicsanalysisoffaecalproteinsinthetickhaemaphysalisflava AT yisongliu proteomicsanalysisoffaecalproteinsinthetickhaemaphysalisflava AT guohualiu proteomicsanalysisoffaecalproteinsinthetickhaemaphysalisflava AT tianyincheng proteomicsanalysisoffaecalproteinsinthetickhaemaphysalisflava |