Disturbance estimation based tracking control for periodic piecewise time‐varying delay systems
Abstract This work is mainly focused on the design of uncertainty and disturbance estimator‐based tracking control scheme for a class of periodic piecewise time‐varying delay systems with uncertainties and disturbances. Precisely, the considered system consists of several subsystems, where the fixed...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2021-02-01
|
| Series: | IET Control Theory & Applications |
| Subjects: | |
| Online Access: | https://doi.org/10.1049/cth2.12055 |
| _version_ | 1818162231523672064 |
|---|---|
| author | Rathinasamy Sakthivel Shanmugam Harshavarthini Nasser‐Eddine Tatar |
| author_facet | Rathinasamy Sakthivel Shanmugam Harshavarthini Nasser‐Eddine Tatar |
| author_sort | Rathinasamy Sakthivel |
| collection | DOAJ |
| description | Abstract This work is mainly focused on the design of uncertainty and disturbance estimator‐based tracking control scheme for a class of periodic piecewise time‐varying delay systems with uncertainties and disturbances. Precisely, the considered system consists of several subsystems, where the fixed dwell time and switching sequence are utilised to achieve the coordination between each subsystem. By constructing Lyapunov–Krasovskii functional with time‐varying periodic piecewise matrices and employing the matrix polynomial approach, an uncertainty and disturbance estimator‐based periodic tracking control design is developed such that the trajectories of the considered system are driven to track the reference model. Moreover, the lumped disturbances so called the summation of uncertainties and exogenous disturbances are estimated with the aid of strictly proper low‐pass filter. Finally, a numerical example is presented to verify the effectiveness and advantages of the developed theoretical results. |
| first_indexed | 2024-12-11T16:30:23Z |
| format | Article |
| id | doaj.art-9335dac8ec3a496bbd33a4a3c28dec2f |
| institution | Directory Open Access Journal |
| issn | 1751-8644 1751-8652 |
| language | English |
| last_indexed | 2024-12-11T16:30:23Z |
| publishDate | 2021-02-01 |
| publisher | Wiley |
| record_format | Article |
| series | IET Control Theory & Applications |
| spelling | doaj.art-9335dac8ec3a496bbd33a4a3c28dec2f2022-12-22T00:58:37ZengWileyIET Control Theory & Applications1751-86441751-86522021-02-0115345947110.1049/cth2.12055Disturbance estimation based tracking control for periodic piecewise time‐varying delay systemsRathinasamy Sakthivel0Shanmugam Harshavarthini1Nasser‐Eddine Tatar2Department of Applied Mathematics Bharathiar University Coimbatore IndiaDepartment of Applied Mathematics Bharathiar University Coimbatore IndiaDepartment of Mathematics and Statistics King Fahd University of Petroleum and Minerals Dhahran Saudi ArabiaAbstract This work is mainly focused on the design of uncertainty and disturbance estimator‐based tracking control scheme for a class of periodic piecewise time‐varying delay systems with uncertainties and disturbances. Precisely, the considered system consists of several subsystems, where the fixed dwell time and switching sequence are utilised to achieve the coordination between each subsystem. By constructing Lyapunov–Krasovskii functional with time‐varying periodic piecewise matrices and employing the matrix polynomial approach, an uncertainty and disturbance estimator‐based periodic tracking control design is developed such that the trajectories of the considered system are driven to track the reference model. Moreover, the lumped disturbances so called the summation of uncertainties and exogenous disturbances are estimated with the aid of strictly proper low‐pass filter. Finally, a numerical example is presented to verify the effectiveness and advantages of the developed theoretical results.https://doi.org/10.1049/cth2.12055Interpolation and function approximation (numerical analysis)Linear algebra (numerical analysis)Control system analysis and synthesis methodsStability in control theoryTime-varying control systemsDistributed parameter control systems |
| spellingShingle | Rathinasamy Sakthivel Shanmugam Harshavarthini Nasser‐Eddine Tatar Disturbance estimation based tracking control for periodic piecewise time‐varying delay systems IET Control Theory & Applications Interpolation and function approximation (numerical analysis) Linear algebra (numerical analysis) Control system analysis and synthesis methods Stability in control theory Time-varying control systems Distributed parameter control systems |
| title | Disturbance estimation based tracking control for periodic piecewise time‐varying delay systems |
| title_full | Disturbance estimation based tracking control for periodic piecewise time‐varying delay systems |
| title_fullStr | Disturbance estimation based tracking control for periodic piecewise time‐varying delay systems |
| title_full_unstemmed | Disturbance estimation based tracking control for periodic piecewise time‐varying delay systems |
| title_short | Disturbance estimation based tracking control for periodic piecewise time‐varying delay systems |
| title_sort | disturbance estimation based tracking control for periodic piecewise time varying delay systems |
| topic | Interpolation and function approximation (numerical analysis) Linear algebra (numerical analysis) Control system analysis and synthesis methods Stability in control theory Time-varying control systems Distributed parameter control systems |
| url | https://doi.org/10.1049/cth2.12055 |
| work_keys_str_mv | AT rathinasamysakthivel disturbanceestimationbasedtrackingcontrolforperiodicpiecewisetimevaryingdelaysystems AT shanmugamharshavarthini disturbanceestimationbasedtrackingcontrolforperiodicpiecewisetimevaryingdelaysystems AT nassereddinetatar disturbanceestimationbasedtrackingcontrolforperiodicpiecewisetimevaryingdelaysystems |