Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques
Abstract Background Female sex hormone secretion and reproductive ability decrease with ageing. Bone marrow mesenchymal stem cells (BMMSCs) have been postulated to play a key role in treating ovarian ageing. Methods We used macaque ovarian ageing models to observe the structural and functional chang...
| Main Authors: | , , , , , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
BMC
2021-08-01
|
| Series: | Stem Cell Research & Therapy |
| Subjects: | |
| Online Access: | https://doi.org/10.1186/s13287-021-02486-4 |
| _version_ | 1818902336996638720 |
|---|---|
| author | Chuan Tian Jie He Yuanyuan An Zailing Yang Donghai Yan Hang Pan Guanke Lv Ye Li Yanying Wang Yukun Yang Gaohong Zhu Zhixu He Xiangqing Zhu Xinghua Pan |
| author_facet | Chuan Tian Jie He Yuanyuan An Zailing Yang Donghai Yan Hang Pan Guanke Lv Ye Li Yanying Wang Yukun Yang Gaohong Zhu Zhixu He Xiangqing Zhu Xinghua Pan |
| author_sort | Chuan Tian |
| collection | DOAJ |
| description | Abstract Background Female sex hormone secretion and reproductive ability decrease with ageing. Bone marrow mesenchymal stem cells (BMMSCs) have been postulated to play a key role in treating ovarian ageing. Methods We used macaque ovarian ageing models to observe the structural and functional changes after juvenile BMMSC treatment. Moreover, RNA-seq was used to analyse the ovarian transcriptional expression profile and key pathways through which BMMSCs reverse ovarian ageing. Results In the elderly macaque models, the ovaries were atrophied, the regulation ability of sex hormones was reduced, the ovarian structure was destroyed, and only local atretic follicles were observed, in contrast with young rhesus monkeys. Intravenous infusion of BMMSCs in elderly macaques increased ovarian volume, strengthened the regulation ability of sex hormones, reduced the degree of pulmonary fibrosis, inhibited apoptosis, increased density of blood vessels, and promoted follicular regeneration. In addition, the ovarian expression characteristics of ageing-related genes of the elderly treatment group reverted to that of the young control group, 1258 genes that were differentially expressed, among which 415 genes upregulated with age were downregulated, 843 genes downregulated with age were upregulated after BMMSC treatment, and the top 20 differentially expressed genes (DEGs) in the protein-protein interaction (PPI) network were significantly enriched in oocyte meiosis and progesterone-mediated oocyte maturation pathways. Conclusion The BMMSCs derived from juvenile macaques can reverse ovarian ageing in elderly macaques. |
| first_indexed | 2024-12-19T20:34:02Z |
| format | Article |
| id | doaj.art-979817d43a164e95b8d875648a8c3a0e |
| institution | Directory Open Access Journal |
| issn | 1757-6512 |
| language | English |
| last_indexed | 2024-12-19T20:34:02Z |
| publishDate | 2021-08-01 |
| publisher | BMC |
| record_format | Article |
| series | Stem Cell Research & Therapy |
| spelling | doaj.art-979817d43a164e95b8d875648a8c3a0e2022-12-21T20:06:36ZengBMCStem Cell Research & Therapy1757-65122021-08-0112111010.1186/s13287-021-02486-4Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaquesChuan Tian0Jie He1Yuanyuan An2Zailing Yang3Donghai Yan4Hang Pan5Guanke Lv6Ye Li7Yanying Wang8Yukun Yang9Gaohong Zhu10Zhixu He11Xiangqing Zhu12Xinghua Pan13The Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsKunming Medical UniversityThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsKunming Medical UniversityGuizhou Medical University, Tissue Engineering and Stem Cell Experimental CenterThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsAbstract Background Female sex hormone secretion and reproductive ability decrease with ageing. Bone marrow mesenchymal stem cells (BMMSCs) have been postulated to play a key role in treating ovarian ageing. Methods We used macaque ovarian ageing models to observe the structural and functional changes after juvenile BMMSC treatment. Moreover, RNA-seq was used to analyse the ovarian transcriptional expression profile and key pathways through which BMMSCs reverse ovarian ageing. Results In the elderly macaque models, the ovaries were atrophied, the regulation ability of sex hormones was reduced, the ovarian structure was destroyed, and only local atretic follicles were observed, in contrast with young rhesus monkeys. Intravenous infusion of BMMSCs in elderly macaques increased ovarian volume, strengthened the regulation ability of sex hormones, reduced the degree of pulmonary fibrosis, inhibited apoptosis, increased density of blood vessels, and promoted follicular regeneration. In addition, the ovarian expression characteristics of ageing-related genes of the elderly treatment group reverted to that of the young control group, 1258 genes that were differentially expressed, among which 415 genes upregulated with age were downregulated, 843 genes downregulated with age were upregulated after BMMSC treatment, and the top 20 differentially expressed genes (DEGs) in the protein-protein interaction (PPI) network were significantly enriched in oocyte meiosis and progesterone-mediated oocyte maturation pathways. Conclusion The BMMSCs derived from juvenile macaques can reverse ovarian ageing in elderly macaques.https://doi.org/10.1186/s13287-021-02486-4MacaqueBMMSCsOvarian ageing |
| spellingShingle | Chuan Tian Jie He Yuanyuan An Zailing Yang Donghai Yan Hang Pan Guanke Lv Ye Li Yanying Wang Yukun Yang Gaohong Zhu Zhixu He Xiangqing Zhu Xinghua Pan Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques Stem Cell Research & Therapy Macaque BMMSCs Ovarian ageing |
| title | Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques |
| title_full | Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques |
| title_fullStr | Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques |
| title_full_unstemmed | Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques |
| title_short | Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques |
| title_sort | bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques |
| topic | Macaque BMMSCs Ovarian ageing |
| url | https://doi.org/10.1186/s13287-021-02486-4 |
| work_keys_str_mv | AT chuantian bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT jiehe bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT yuanyuanan bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT zailingyang bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT donghaiyan bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT hangpan bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT guankelv bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT yeli bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT yanyingwang bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT yukunyang bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT gaohongzhu bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT zhixuhe bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT xiangqingzhu bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques AT xinghuapan bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques |