Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques

Abstract Background Female sex hormone secretion and reproductive ability decrease with ageing. Bone marrow mesenchymal stem cells (BMMSCs) have been postulated to play a key role in treating ovarian ageing. Methods We used macaque ovarian ageing models to observe the structural and functional chang...

Full description

Bibliographic Details
Main Authors: Chuan Tian, Jie He, Yuanyuan An, Zailing Yang, Donghai Yan, Hang Pan, Guanke Lv, Ye Li, Yanying Wang, Yukun Yang, Gaohong Zhu, Zhixu He, Xiangqing Zhu, Xinghua Pan
Format: Article
Language:English
Published: BMC 2021-08-01
Series:Stem Cell Research & Therapy
Subjects:
Online Access:https://doi.org/10.1186/s13287-021-02486-4
_version_ 1818902336996638720
author Chuan Tian
Jie He
Yuanyuan An
Zailing Yang
Donghai Yan
Hang Pan
Guanke Lv
Ye Li
Yanying Wang
Yukun Yang
Gaohong Zhu
Zhixu He
Xiangqing Zhu
Xinghua Pan
author_facet Chuan Tian
Jie He
Yuanyuan An
Zailing Yang
Donghai Yan
Hang Pan
Guanke Lv
Ye Li
Yanying Wang
Yukun Yang
Gaohong Zhu
Zhixu He
Xiangqing Zhu
Xinghua Pan
author_sort Chuan Tian
collection DOAJ
description Abstract Background Female sex hormone secretion and reproductive ability decrease with ageing. Bone marrow mesenchymal stem cells (BMMSCs) have been postulated to play a key role in treating ovarian ageing. Methods We used macaque ovarian ageing models to observe the structural and functional changes after juvenile BMMSC treatment. Moreover, RNA-seq was used to analyse the ovarian transcriptional expression profile and key pathways through which BMMSCs reverse ovarian ageing. Results In the elderly macaque models, the ovaries were atrophied, the regulation ability of sex hormones was reduced, the ovarian structure was destroyed, and only local atretic follicles were observed, in contrast with young rhesus monkeys. Intravenous infusion of BMMSCs in elderly macaques increased ovarian volume, strengthened the regulation ability of sex hormones, reduced the degree of pulmonary fibrosis, inhibited apoptosis, increased density of blood vessels, and promoted follicular regeneration. In addition, the ovarian expression characteristics of ageing-related genes of the elderly treatment group reverted to that of the young control group, 1258 genes that were differentially expressed, among which 415 genes upregulated with age were downregulated, 843 genes downregulated with age were upregulated after BMMSC treatment, and the top 20 differentially expressed genes (DEGs) in the protein-protein interaction (PPI) network were significantly enriched in oocyte meiosis and progesterone-mediated oocyte maturation pathways. Conclusion The BMMSCs derived from juvenile macaques can reverse ovarian ageing in elderly macaques.
first_indexed 2024-12-19T20:34:02Z
format Article
id doaj.art-979817d43a164e95b8d875648a8c3a0e
institution Directory Open Access Journal
issn 1757-6512
language English
last_indexed 2024-12-19T20:34:02Z
publishDate 2021-08-01
publisher BMC
record_format Article
series Stem Cell Research & Therapy
spelling doaj.art-979817d43a164e95b8d875648a8c3a0e2022-12-21T20:06:36ZengBMCStem Cell Research & Therapy1757-65122021-08-0112111010.1186/s13287-021-02486-4Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaquesChuan Tian0Jie He1Yuanyuan An2Zailing Yang3Donghai Yan4Hang Pan5Guanke Lv6Ye Li7Yanying Wang8Yukun Yang9Gaohong Zhu10Zhixu He11Xiangqing Zhu12Xinghua Pan13The Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsKunming Medical UniversityThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsKunming Medical UniversityGuizhou Medical University, Tissue Engineering and Stem Cell Experimental CenterThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsThe Basic Medical Laboratory of the 920th Hospital of Joint Logistics Support Force of PLA, The Transfer Medicine Key Laboratory of Cell Therapy Technology of Yunan Province, The Integrated Engineering Laboratory of Cell Biological Medicine of State and RegionsAbstract Background Female sex hormone secretion and reproductive ability decrease with ageing. Bone marrow mesenchymal stem cells (BMMSCs) have been postulated to play a key role in treating ovarian ageing. Methods We used macaque ovarian ageing models to observe the structural and functional changes after juvenile BMMSC treatment. Moreover, RNA-seq was used to analyse the ovarian transcriptional expression profile and key pathways through which BMMSCs reverse ovarian ageing. Results In the elderly macaque models, the ovaries were atrophied, the regulation ability of sex hormones was reduced, the ovarian structure was destroyed, and only local atretic follicles were observed, in contrast with young rhesus monkeys. Intravenous infusion of BMMSCs in elderly macaques increased ovarian volume, strengthened the regulation ability of sex hormones, reduced the degree of pulmonary fibrosis, inhibited apoptosis, increased density of blood vessels, and promoted follicular regeneration. In addition, the ovarian expression characteristics of ageing-related genes of the elderly treatment group reverted to that of the young control group, 1258 genes that were differentially expressed, among which 415 genes upregulated with age were downregulated, 843 genes downregulated with age were upregulated after BMMSC treatment, and the top 20 differentially expressed genes (DEGs) in the protein-protein interaction (PPI) network were significantly enriched in oocyte meiosis and progesterone-mediated oocyte maturation pathways. Conclusion The BMMSCs derived from juvenile macaques can reverse ovarian ageing in elderly macaques.https://doi.org/10.1186/s13287-021-02486-4MacaqueBMMSCsOvarian ageing
spellingShingle Chuan Tian
Jie He
Yuanyuan An
Zailing Yang
Donghai Yan
Hang Pan
Guanke Lv
Ye Li
Yanying Wang
Yukun Yang
Gaohong Zhu
Zhixu He
Xiangqing Zhu
Xinghua Pan
Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques
Stem Cell Research & Therapy
Macaque
BMMSCs
Ovarian ageing
title Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques
title_full Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques
title_fullStr Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques
title_full_unstemmed Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques
title_short Bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques
title_sort bone marrow mesenchymal stem cells derived from juvenile macaques reversed ovarian ageing in elderly macaques
topic Macaque
BMMSCs
Ovarian ageing
url https://doi.org/10.1186/s13287-021-02486-4
work_keys_str_mv AT chuantian bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT jiehe bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT yuanyuanan bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT zailingyang bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT donghaiyan bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT hangpan bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT guankelv bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT yeli bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT yanyingwang bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT yukunyang bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT gaohongzhu bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT zhixuhe bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT xiangqingzhu bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques
AT xinghuapan bonemarrowmesenchymalstemcellsderivedfromjuvenilemacaquesreversedovarianageinginelderlymacaques