Serum Gamma GlutamylTransferase, Amylase and Alkaline Phosphatase activities in kidney diseases.
Background: The study enrolled a total of 78 patients with acute and chronic kidney diseases for evaluation of the activity of enzymes, gamma-glutamyltransferase (GGT), alkaline phosphatase (ALP) and amylase and compared with 42 normal healthy groups with normal albumin, creatinine and other kidney...
| Main Author: | |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
College of Medicine University of Baghdad
2010-07-01
|
| Series: | مجلة كلية الطب |
| Subjects: | |
| Online Access: | http://iqjmc.uobaghdad.edu.iq/index.php/19JFacMedBaghdad36/article/view/1025 |
| _version_ | 1797368679033208832 |
|---|---|
| author | Mayssoon M. Najeeb M. Saleem |
| author_facet | Mayssoon M. Najeeb M. Saleem |
| author_sort | Mayssoon M. Najeeb M. Saleem |
| collection | DOAJ |
| description | Background: The study enrolled a total of 78 patients with acute and chronic kidney diseases for evaluation of the activity of enzymes, gamma-glutamyltransferase (GGT), alkaline phosphatase (ALP) and amylase and compared with 42 normal healthy groups with normal albumin, creatinine and other kidney functions test and the samples were obtained from different hospitals in Baghdad.
Patients and methods: Three groups of patients were included. The first group consists of 15 patients with acute kidney diseases that occurs over days to weeks in which measurement of GGT, ALP and amylase were performed. Second group consists of 38 patients suffering from acute kidney diseases for 2-3 months in which serum GGT was evaluated .Third group consist of 25 patients with chronic kidney diseases used for estimation of GGT, ALP and amylase and other biochemical parameters, total cholesterol, urea, creatinine, uric acid and total protein.
Results: There was statistically highly significant difference in the activity of enzymes GGT, ALP and amylase P< 0.001 for three groups of patients with acute kidney diseases, and there was a remarkable difference in GGT activity with chronic kidney diseases (P < 0.001).
Conclusion: Acute and chronic kidney diseases in human was diagnosed by measurement of enzyme GGT, ALP, and amylase activities |
| first_indexed | 2024-03-08T17:36:04Z |
| format | Article |
| id | doaj.art-9c696de7cb6845a2a2cbec050d566adb |
| institution | Directory Open Access Journal |
| issn | 0041-9419 2410-8057 |
| language | English |
| last_indexed | 2024-03-08T17:36:04Z |
| publishDate | 2010-07-01 |
| publisher | College of Medicine University of Baghdad |
| record_format | Article |
| series | مجلة كلية الطب |
| spelling | doaj.art-9c696de7cb6845a2a2cbec050d566adb2024-01-02T12:39:25ZengCollege of Medicine University of Baghdadمجلة كلية الطب0041-94192410-80572010-07-0152210.32007/jfacmedbagdad.v2207-211%Serum Gamma GlutamylTransferase, Amylase and Alkaline Phosphatase activities in kidney diseases.Mayssoon M. Najeeb M. Saleem0Department of Biochemical Technology Division Applied Science, University of Technology.Background: The study enrolled a total of 78 patients with acute and chronic kidney diseases for evaluation of the activity of enzymes, gamma-glutamyltransferase (GGT), alkaline phosphatase (ALP) and amylase and compared with 42 normal healthy groups with normal albumin, creatinine and other kidney functions test and the samples were obtained from different hospitals in Baghdad. Patients and methods: Three groups of patients were included. The first group consists of 15 patients with acute kidney diseases that occurs over days to weeks in which measurement of GGT, ALP and amylase were performed. Second group consists of 38 patients suffering from acute kidney diseases for 2-3 months in which serum GGT was evaluated .Third group consist of 25 patients with chronic kidney diseases used for estimation of GGT, ALP and amylase and other biochemical parameters, total cholesterol, urea, creatinine, uric acid and total protein. Results: There was statistically highly significant difference in the activity of enzymes GGT, ALP and amylase P< 0.001 for three groups of patients with acute kidney diseases, and there was a remarkable difference in GGT activity with chronic kidney diseases (P < 0.001). Conclusion: Acute and chronic kidney diseases in human was diagnosed by measurement of enzyme GGT, ALP, and amylase activitieshttp://iqjmc.uobaghdad.edu.iq/index.php/19JFacMedBaghdad36/article/view/1025Chronic kidney disease, acute kidney disease, GGT, ALP, Amylase. |
| spellingShingle | Mayssoon M. Najeeb M. Saleem Serum Gamma GlutamylTransferase, Amylase and Alkaline Phosphatase activities in kidney diseases. مجلة كلية الطب Chronic kidney disease, acute kidney disease, GGT, ALP, Amylase. |
| title | Serum Gamma GlutamylTransferase, Amylase and Alkaline Phosphatase activities in kidney diseases. |
| title_full | Serum Gamma GlutamylTransferase, Amylase and Alkaline Phosphatase activities in kidney diseases. |
| title_fullStr | Serum Gamma GlutamylTransferase, Amylase and Alkaline Phosphatase activities in kidney diseases. |
| title_full_unstemmed | Serum Gamma GlutamylTransferase, Amylase and Alkaline Phosphatase activities in kidney diseases. |
| title_short | Serum Gamma GlutamylTransferase, Amylase and Alkaline Phosphatase activities in kidney diseases. |
| title_sort | serum gamma glutamyltransferase amylase and alkaline phosphatase activities in kidney diseases |
| topic | Chronic kidney disease, acute kidney disease, GGT, ALP, Amylase. |
| url | http://iqjmc.uobaghdad.edu.iq/index.php/19JFacMedBaghdad36/article/view/1025 |
| work_keys_str_mv | AT mayssoonmnajeebmsaleem serumgammaglutamyltransferaseamylaseandalkalinephosphataseactivitiesinkidneydiseases |