Mck1 kinase is a new player in the DNA damage checkpoint pathway.

Bibliographic Details
Main Authors: Nerea Sanvisens Delgado, David P Toczyski
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2019-10-01
Series:PLoS Genetics
Online Access:https://doi.org/10.1371/journal.pgen.1008372
_version_ 1818348785202364416
author Nerea Sanvisens Delgado
David P Toczyski
author_facet Nerea Sanvisens Delgado
David P Toczyski
author_sort Nerea Sanvisens Delgado
collection DOAJ
first_indexed 2024-12-13T17:55:34Z
format Article
id doaj.art-a0519ad32d5e484495860222df9fa968
institution Directory Open Access Journal
issn 1553-7390
1553-7404
language English
last_indexed 2024-12-13T17:55:34Z
publishDate 2019-10-01
publisher Public Library of Science (PLoS)
record_format Article
series PLoS Genetics
spelling doaj.art-a0519ad32d5e484495860222df9fa9682022-12-21T23:36:23ZengPublic Library of Science (PLoS)PLoS Genetics1553-73901553-74042019-10-011510e100837210.1371/journal.pgen.1008372Mck1 kinase is a new player in the DNA damage checkpoint pathway.Nerea Sanvisens DelgadoDavid P Toczyskihttps://doi.org/10.1371/journal.pgen.1008372
spellingShingle Nerea Sanvisens Delgado
David P Toczyski
Mck1 kinase is a new player in the DNA damage checkpoint pathway.
PLoS Genetics
title Mck1 kinase is a new player in the DNA damage checkpoint pathway.
title_full Mck1 kinase is a new player in the DNA damage checkpoint pathway.
title_fullStr Mck1 kinase is a new player in the DNA damage checkpoint pathway.
title_full_unstemmed Mck1 kinase is a new player in the DNA damage checkpoint pathway.
title_short Mck1 kinase is a new player in the DNA damage checkpoint pathway.
title_sort mck1 kinase is a new player in the dna damage checkpoint pathway
url https://doi.org/10.1371/journal.pgen.1008372
work_keys_str_mv AT nereasanvisensdelgado mck1kinaseisanewplayerinthednadamagecheckpointpathway
AT davidptoczyski mck1kinaseisanewplayerinthednadamagecheckpointpathway