Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance

Late embryogenesis abundant (LEA) proteins are identified in many crops for their response and role in adaptation to various abiotic stresses, such as drought, salinity, and temperature. The LEA genes have been studied systematically in several crops but not in Vigna crops. In this study, we reporte...

Full description

Bibliographic Details
Main Authors: Chandra Mohan Singh, Mukul Kumar, Aditya Pratap, Anupam Tripathi, Smita Singh, Anuj Mishra, Hitesh Kumar, Ramkrishnan M. Nair, Narendra Pratap Singh
Format: Article
Language:English
Published: Frontiers Media S.A. 2022-03-01
Series:Frontiers in Plant Science
Subjects:
Online Access:https://www.frontiersin.org/articles/10.3389/fpls.2022.843107/full
_version_ 1811272641104838656
author Chandra Mohan Singh
Mukul Kumar
Aditya Pratap
Anupam Tripathi
Smita Singh
Anuj Mishra
Hitesh Kumar
Ramkrishnan M. Nair
Narendra Pratap Singh
author_facet Chandra Mohan Singh
Mukul Kumar
Aditya Pratap
Anupam Tripathi
Smita Singh
Anuj Mishra
Hitesh Kumar
Ramkrishnan M. Nair
Narendra Pratap Singh
author_sort Chandra Mohan Singh
collection DOAJ
description Late embryogenesis abundant (LEA) proteins are identified in many crops for their response and role in adaptation to various abiotic stresses, such as drought, salinity, and temperature. The LEA genes have been studied systematically in several crops but not in Vigna crops. In this study, we reported the first comprehensive analysis of the LEA gene family in three legume species, namely, mung bean (Vigna radiata), adzuki bean (Vigna angularis), and cowpea (Vigna unguiculata), and the cross-species expression of VrLEA genes in a wild tetraploid species, Vigna glabrescens. A total of 201 LEA genes from three Vigna crops were identified harboring the LEA conserved motif. Among these 55, 64, and 82 LEA genes were identified in mung bean, adzuki bean, and cowpea genomes, respectively. These LEA genes were grouped into eight different classes. Our analysis revealed that the cowpea genome comprised all eight classes of LEA genes, whereas the LEA-6 class was absent in the mung bean genome. Similarly, LEA-5 and LEA-6 were absent in the adzuki bean genome. The analysis of LEA genes provides an insight into their structural and functional diversity in the Vigna genome. The genes, such as VrLEA-2, VrLEA-40, VrLEA-47, and VrLEA-55, were significantly upregulated in the heat-tolerant genotype under stress conditions indicating the basis of heat tolerance. The successful amplification and expression of VrLEA genes in V. glabrescens indicated the utility of the developed markers in mung bean improvement. The results of this study increase our understanding of LEA genes and provide robust candidate genes for future functional investigations and a basis for improving heat stress tolerance in Vigna crops.
first_indexed 2024-04-12T22:44:01Z
format Article
id doaj.art-a15998cf5f7b4660bbbbeb32153732cf
institution Directory Open Access Journal
issn 1664-462X
language English
last_indexed 2024-04-12T22:44:01Z
publishDate 2022-03-01
publisher Frontiers Media S.A.
record_format Article
series Frontiers in Plant Science
spelling doaj.art-a15998cf5f7b4660bbbbeb32153732cf2022-12-22T03:13:37ZengFrontiers Media S.A.Frontiers in Plant Science1664-462X2022-03-011310.3389/fpls.2022.843107843107Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat ToleranceChandra Mohan Singh0Mukul Kumar1Aditya Pratap2Anupam Tripathi3Smita Singh4Anuj Mishra5Hitesh Kumar6Ramkrishnan M. Nair7Narendra Pratap Singh8Department of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaDepartment of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaICAR-Indian Institute of Pulses Research, Kanpur, IndiaDepartment of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaDepartment of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaDepartment of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaDepartment of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaWorld Vegetable Center South Asia, Hyderabad, IndiaDepartment of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaLate embryogenesis abundant (LEA) proteins are identified in many crops for their response and role in adaptation to various abiotic stresses, such as drought, salinity, and temperature. The LEA genes have been studied systematically in several crops but not in Vigna crops. In this study, we reported the first comprehensive analysis of the LEA gene family in three legume species, namely, mung bean (Vigna radiata), adzuki bean (Vigna angularis), and cowpea (Vigna unguiculata), and the cross-species expression of VrLEA genes in a wild tetraploid species, Vigna glabrescens. A total of 201 LEA genes from three Vigna crops were identified harboring the LEA conserved motif. Among these 55, 64, and 82 LEA genes were identified in mung bean, adzuki bean, and cowpea genomes, respectively. These LEA genes were grouped into eight different classes. Our analysis revealed that the cowpea genome comprised all eight classes of LEA genes, whereas the LEA-6 class was absent in the mung bean genome. Similarly, LEA-5 and LEA-6 were absent in the adzuki bean genome. The analysis of LEA genes provides an insight into their structural and functional diversity in the Vigna genome. The genes, such as VrLEA-2, VrLEA-40, VrLEA-47, and VrLEA-55, were significantly upregulated in the heat-tolerant genotype under stress conditions indicating the basis of heat tolerance. The successful amplification and expression of VrLEA genes in V. glabrescens indicated the utility of the developed markers in mung bean improvement. The results of this study increase our understanding of LEA genes and provide robust candidate genes for future functional investigations and a basis for improving heat stress tolerance in Vigna crops.https://www.frontiersin.org/articles/10.3389/fpls.2022.843107/fullabiotic stresscandidate genesexpression analysisheat stressmung beanwild Vigna
spellingShingle Chandra Mohan Singh
Mukul Kumar
Aditya Pratap
Anupam Tripathi
Smita Singh
Anuj Mishra
Hitesh Kumar
Ramkrishnan M. Nair
Narendra Pratap Singh
Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance
Frontiers in Plant Science
abiotic stress
candidate genes
expression analysis
heat stress
mung bean
wild Vigna
title Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance
title_full Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance
title_fullStr Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance
title_full_unstemmed Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance
title_short Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance
title_sort genome wide analysis of late embryogenesis abundant protein gene family in vigna species and expression of vrlea encoding genes in vigna glabrescens reveal its role in heat tolerance
topic abiotic stress
candidate genes
expression analysis
heat stress
mung bean
wild Vigna
url https://www.frontiersin.org/articles/10.3389/fpls.2022.843107/full
work_keys_str_mv AT chandramohansingh genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance
AT mukulkumar genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance
AT adityapratap genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance
AT anupamtripathi genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance
AT smitasingh genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance
AT anujmishra genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance
AT hiteshkumar genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance
AT ramkrishnanmnair genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance
AT narendrapratapsingh genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance