Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance
Late embryogenesis abundant (LEA) proteins are identified in many crops for their response and role in adaptation to various abiotic stresses, such as drought, salinity, and temperature. The LEA genes have been studied systematically in several crops but not in Vigna crops. In this study, we reporte...
Main Authors: | , , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Frontiers Media S.A.
2022-03-01
|
Series: | Frontiers in Plant Science |
Subjects: | |
Online Access: | https://www.frontiersin.org/articles/10.3389/fpls.2022.843107/full |
_version_ | 1811272641104838656 |
---|---|
author | Chandra Mohan Singh Mukul Kumar Aditya Pratap Anupam Tripathi Smita Singh Anuj Mishra Hitesh Kumar Ramkrishnan M. Nair Narendra Pratap Singh |
author_facet | Chandra Mohan Singh Mukul Kumar Aditya Pratap Anupam Tripathi Smita Singh Anuj Mishra Hitesh Kumar Ramkrishnan M. Nair Narendra Pratap Singh |
author_sort | Chandra Mohan Singh |
collection | DOAJ |
description | Late embryogenesis abundant (LEA) proteins are identified in many crops for their response and role in adaptation to various abiotic stresses, such as drought, salinity, and temperature. The LEA genes have been studied systematically in several crops but not in Vigna crops. In this study, we reported the first comprehensive analysis of the LEA gene family in three legume species, namely, mung bean (Vigna radiata), adzuki bean (Vigna angularis), and cowpea (Vigna unguiculata), and the cross-species expression of VrLEA genes in a wild tetraploid species, Vigna glabrescens. A total of 201 LEA genes from three Vigna crops were identified harboring the LEA conserved motif. Among these 55, 64, and 82 LEA genes were identified in mung bean, adzuki bean, and cowpea genomes, respectively. These LEA genes were grouped into eight different classes. Our analysis revealed that the cowpea genome comprised all eight classes of LEA genes, whereas the LEA-6 class was absent in the mung bean genome. Similarly, LEA-5 and LEA-6 were absent in the adzuki bean genome. The analysis of LEA genes provides an insight into their structural and functional diversity in the Vigna genome. The genes, such as VrLEA-2, VrLEA-40, VrLEA-47, and VrLEA-55, were significantly upregulated in the heat-tolerant genotype under stress conditions indicating the basis of heat tolerance. The successful amplification and expression of VrLEA genes in V. glabrescens indicated the utility of the developed markers in mung bean improvement. The results of this study increase our understanding of LEA genes and provide robust candidate genes for future functional investigations and a basis for improving heat stress tolerance in Vigna crops. |
first_indexed | 2024-04-12T22:44:01Z |
format | Article |
id | doaj.art-a15998cf5f7b4660bbbbeb32153732cf |
institution | Directory Open Access Journal |
issn | 1664-462X |
language | English |
last_indexed | 2024-04-12T22:44:01Z |
publishDate | 2022-03-01 |
publisher | Frontiers Media S.A. |
record_format | Article |
series | Frontiers in Plant Science |
spelling | doaj.art-a15998cf5f7b4660bbbbeb32153732cf2022-12-22T03:13:37ZengFrontiers Media S.A.Frontiers in Plant Science1664-462X2022-03-011310.3389/fpls.2022.843107843107Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat ToleranceChandra Mohan Singh0Mukul Kumar1Aditya Pratap2Anupam Tripathi3Smita Singh4Anuj Mishra5Hitesh Kumar6Ramkrishnan M. Nair7Narendra Pratap Singh8Department of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaDepartment of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaICAR-Indian Institute of Pulses Research, Kanpur, IndiaDepartment of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaDepartment of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaDepartment of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaDepartment of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaWorld Vegetable Center South Asia, Hyderabad, IndiaDepartment of Genetics and Plant Breeding, Banda University of Agriculture and Technology, Banda, IndiaLate embryogenesis abundant (LEA) proteins are identified in many crops for their response and role in adaptation to various abiotic stresses, such as drought, salinity, and temperature. The LEA genes have been studied systematically in several crops but not in Vigna crops. In this study, we reported the first comprehensive analysis of the LEA gene family in three legume species, namely, mung bean (Vigna radiata), adzuki bean (Vigna angularis), and cowpea (Vigna unguiculata), and the cross-species expression of VrLEA genes in a wild tetraploid species, Vigna glabrescens. A total of 201 LEA genes from three Vigna crops were identified harboring the LEA conserved motif. Among these 55, 64, and 82 LEA genes were identified in mung bean, adzuki bean, and cowpea genomes, respectively. These LEA genes were grouped into eight different classes. Our analysis revealed that the cowpea genome comprised all eight classes of LEA genes, whereas the LEA-6 class was absent in the mung bean genome. Similarly, LEA-5 and LEA-6 were absent in the adzuki bean genome. The analysis of LEA genes provides an insight into their structural and functional diversity in the Vigna genome. The genes, such as VrLEA-2, VrLEA-40, VrLEA-47, and VrLEA-55, were significantly upregulated in the heat-tolerant genotype under stress conditions indicating the basis of heat tolerance. The successful amplification and expression of VrLEA genes in V. glabrescens indicated the utility of the developed markers in mung bean improvement. The results of this study increase our understanding of LEA genes and provide robust candidate genes for future functional investigations and a basis for improving heat stress tolerance in Vigna crops.https://www.frontiersin.org/articles/10.3389/fpls.2022.843107/fullabiotic stresscandidate genesexpression analysisheat stressmung beanwild Vigna |
spellingShingle | Chandra Mohan Singh Mukul Kumar Aditya Pratap Anupam Tripathi Smita Singh Anuj Mishra Hitesh Kumar Ramkrishnan M. Nair Narendra Pratap Singh Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance Frontiers in Plant Science abiotic stress candidate genes expression analysis heat stress mung bean wild Vigna |
title | Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance |
title_full | Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance |
title_fullStr | Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance |
title_full_unstemmed | Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance |
title_short | Genome-Wide Analysis of Late Embryogenesis Abundant Protein Gene Family in Vigna Species and Expression of VrLEA Encoding Genes in Vigna glabrescens Reveal Its Role in Heat Tolerance |
title_sort | genome wide analysis of late embryogenesis abundant protein gene family in vigna species and expression of vrlea encoding genes in vigna glabrescens reveal its role in heat tolerance |
topic | abiotic stress candidate genes expression analysis heat stress mung bean wild Vigna |
url | https://www.frontiersin.org/articles/10.3389/fpls.2022.843107/full |
work_keys_str_mv | AT chandramohansingh genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance AT mukulkumar genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance AT adityapratap genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance AT anupamtripathi genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance AT smitasingh genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance AT anujmishra genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance AT hiteshkumar genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance AT ramkrishnanmnair genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance AT narendrapratapsingh genomewideanalysisoflateembryogenesisabundantproteingenefamilyinvignaspeciesandexpressionofvrleaencodinggenesinvignaglabrescensrevealitsroleinheattolerance |