Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway
Chinese kale is a vegetable belonging to the family Brassicaceae in which members of this family produce unique metabolites called glucosinolates and isothiocyanates. These substances have been found to exhibit many benefits to human health. This study aimed to investigate and compare the contents o...
Main Authors: | , , |
---|---|
Format: | Article |
Language: | English |
Published: |
MDPI AG
2023-03-01
|
Series: | Foods |
Subjects: | |
Online Access: | https://www.mdpi.com/2304-8158/12/7/1471 |
_version_ | 1797607964971892736 |
---|---|
author | Siriphorn Pungpuag Somchai Boonpangrak Yaneenart Suwanwong |
author_facet | Siriphorn Pungpuag Somchai Boonpangrak Yaneenart Suwanwong |
author_sort | Siriphorn Pungpuag |
collection | DOAJ |
description | Chinese kale is a vegetable belonging to the family Brassicaceae in which members of this family produce unique metabolites called glucosinolates and isothiocyanates. These substances have been found to exhibit many benefits to human health. This study aimed to investigate and compare the contents of glucosinolates and isothiocyanates, and the anti-leukemic activity of fresh and steamed Chinese kale juice (CKJ). Cell viability and proliferation activity of U937 cells treated with CKJ were determined. Cell apoptosis and alterations of apoptosis-related protein expression were studied. Results showed that CKJ significantly decreased the viability of leukemic cells and inhibited cell proliferation in a dose- and time-dependent manner. After treatment with 5% <i>v</i>/<i>v</i> fresh and steamed CKJ for 24 h, the percentage of apoptotic cells increased to 53% and 36%, respectively. Increased amounts of cleaved caspase-3 in U937 cells treated with CKJ were observed, indicating that CKJ can trigger apoptotic cell death through a caspase-dependent pathway. Fresh CKJ was found to be more effective than steamed CKJ in suppressing cell survival and inducing cell apoptosis. The results suggest that Chinese kale possesses an anti-leukemic potential and could be further developed for cancer therapy and prevention. However, thermal cooking could reduce its beneficial function. |
first_indexed | 2024-03-11T05:37:02Z |
format | Article |
id | doaj.art-a21780e0450d4385a9678385a71176c0 |
institution | Directory Open Access Journal |
issn | 2304-8158 |
language | English |
last_indexed | 2024-03-11T05:37:02Z |
publishDate | 2023-03-01 |
publisher | MDPI AG |
record_format | Article |
series | Foods |
spelling | doaj.art-a21780e0450d4385a9678385a71176c02023-11-17T16:41:47ZengMDPI AGFoods2304-81582023-03-01127147110.3390/foods12071471Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent PathwaySiriphorn Pungpuag0Somchai Boonpangrak1Yaneenart Suwanwong2Clinical Hematology Sciences Program, Faculty of Allied Health Sciences, Chulalongkorn University, Bangkok 10330, ThailandCenter for Research and Innovation, Faculty of Medical Technology, Mahidol University, Nakhon Pathom 73170, ThailandDepartment of Clinical Microscopy, Faculty of Allied Health Sciences, Chulalongkorn University, Bangkok 10330, ThailandChinese kale is a vegetable belonging to the family Brassicaceae in which members of this family produce unique metabolites called glucosinolates and isothiocyanates. These substances have been found to exhibit many benefits to human health. This study aimed to investigate and compare the contents of glucosinolates and isothiocyanates, and the anti-leukemic activity of fresh and steamed Chinese kale juice (CKJ). Cell viability and proliferation activity of U937 cells treated with CKJ were determined. Cell apoptosis and alterations of apoptosis-related protein expression were studied. Results showed that CKJ significantly decreased the viability of leukemic cells and inhibited cell proliferation in a dose- and time-dependent manner. After treatment with 5% <i>v</i>/<i>v</i> fresh and steamed CKJ for 24 h, the percentage of apoptotic cells increased to 53% and 36%, respectively. Increased amounts of cleaved caspase-3 in U937 cells treated with CKJ were observed, indicating that CKJ can trigger apoptotic cell death through a caspase-dependent pathway. Fresh CKJ was found to be more effective than steamed CKJ in suppressing cell survival and inducing cell apoptosis. The results suggest that Chinese kale possesses an anti-leukemic potential and could be further developed for cancer therapy and prevention. However, thermal cooking could reduce its beneficial function.https://www.mdpi.com/2304-8158/12/7/1471apoptosis<i>Brassica</i>cancerglucosinolateisothiocyanatekale |
spellingShingle | Siriphorn Pungpuag Somchai Boonpangrak Yaneenart Suwanwong Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway Foods apoptosis <i>Brassica</i> cancer glucosinolate isothiocyanate kale |
title | Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway |
title_full | Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway |
title_fullStr | Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway |
title_full_unstemmed | Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway |
title_short | Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway |
title_sort | anti leukemic effects on a u937 cell line of fresh and steamed chinese kale juice and their pro apoptotic effects via a caspase dependent pathway |
topic | apoptosis <i>Brassica</i> cancer glucosinolate isothiocyanate kale |
url | https://www.mdpi.com/2304-8158/12/7/1471 |
work_keys_str_mv | AT siriphornpungpuag antileukemiceffectsonau937celllineoffreshandsteamedchinesekalejuiceandtheirproapoptoticeffectsviaacaspasedependentpathway AT somchaiboonpangrak antileukemiceffectsonau937celllineoffreshandsteamedchinesekalejuiceandtheirproapoptoticeffectsviaacaspasedependentpathway AT yaneenartsuwanwong antileukemiceffectsonau937celllineoffreshandsteamedchinesekalejuiceandtheirproapoptoticeffectsviaacaspasedependentpathway |