The prostaglandin D2 receptor 2 pathway in asthma: a key player in airway inflammation
Abstract Asthma is characterised by chronic airway inflammation, airway obstruction and hyper-responsiveness. The inflammatory cascade in asthma comprises a complex interplay of genetic factors, the airway epithelium, and dysregulation of the immune response. Prostaglandin D2 (PGD2) is a lipid media...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
BMC
2018-09-01
|
| Series: | Respiratory Research |
| Subjects: | |
| Online Access: | http://link.springer.com/article/10.1186/s12931-018-0893-x |
| _version_ | 1818550353776345088 |
|---|---|
| author | Christian Domingo Oscar Palomares David A. Sandham Veit J. Erpenbeck Pablo Altman |
| author_facet | Christian Domingo Oscar Palomares David A. Sandham Veit J. Erpenbeck Pablo Altman |
| author_sort | Christian Domingo |
| collection | DOAJ |
| description | Abstract Asthma is characterised by chronic airway inflammation, airway obstruction and hyper-responsiveness. The inflammatory cascade in asthma comprises a complex interplay of genetic factors, the airway epithelium, and dysregulation of the immune response. Prostaglandin D2 (PGD2) is a lipid mediator, predominantly released from mast cells, but also by other immune cells such as TH2 cells and dendritic cells, which plays a significant role in the pathophysiology of asthma. PGD2 mainly exerts its biological functions via two G-protein-coupled receptors, the PGD2 receptor 1 (DP1) and 2 (DP2). The DP2 receptor is mainly expressed by the key cells involved in type 2 immune responses, including TH2 cells, type 2 innate lymphoid cells and eosinophils. The DP2 receptor pathway is a novel and important therapeutic target for asthma, because increased PGD2 production induces significant inflammatory cell chemotaxis and degranulation via its interaction with the DP2 receptor. This interaction has serious consequences in the pulmonary milieu, including the release of pro-inflammatory cytokines and harmful cationic proteases, leading to tissue remodelling, mucus production, structural damage, and compromised lung function. This review will discuss the importance of the DP2 receptor pathway and the current understanding of its role in asthma. |
| first_indexed | 2024-12-12T08:45:19Z |
| format | Article |
| id | doaj.art-a5f93f7614e143f0b63e7d951a9d2a80 |
| institution | Directory Open Access Journal |
| issn | 1465-993X |
| language | English |
| last_indexed | 2024-12-12T08:45:19Z |
| publishDate | 2018-09-01 |
| publisher | BMC |
| record_format | Article |
| series | Respiratory Research |
| spelling | doaj.art-a5f93f7614e143f0b63e7d951a9d2a802022-12-22T00:30:35ZengBMCRespiratory Research1465-993X2018-09-011911810.1186/s12931-018-0893-xThe prostaglandin D2 receptor 2 pathway in asthma: a key player in airway inflammationChristian Domingo0Oscar Palomares1David A. Sandham2Veit J. Erpenbeck3Pablo Altman4Department of Medicine, Universitat Autònoma de BarcelonaDepartment of Biochemistry and Molecular Biology, School of Chemistry, Complutense University of MadridNovartis Institutes for Biomedical ResearchNovartis Pharma AGNovartis Pharmaceuticals CorporationAbstract Asthma is characterised by chronic airway inflammation, airway obstruction and hyper-responsiveness. The inflammatory cascade in asthma comprises a complex interplay of genetic factors, the airway epithelium, and dysregulation of the immune response. Prostaglandin D2 (PGD2) is a lipid mediator, predominantly released from mast cells, but also by other immune cells such as TH2 cells and dendritic cells, which plays a significant role in the pathophysiology of asthma. PGD2 mainly exerts its biological functions via two G-protein-coupled receptors, the PGD2 receptor 1 (DP1) and 2 (DP2). The DP2 receptor is mainly expressed by the key cells involved in type 2 immune responses, including TH2 cells, type 2 innate lymphoid cells and eosinophils. The DP2 receptor pathway is a novel and important therapeutic target for asthma, because increased PGD2 production induces significant inflammatory cell chemotaxis and degranulation via its interaction with the DP2 receptor. This interaction has serious consequences in the pulmonary milieu, including the release of pro-inflammatory cytokines and harmful cationic proteases, leading to tissue remodelling, mucus production, structural damage, and compromised lung function. This review will discuss the importance of the DP2 receptor pathway and the current understanding of its role in asthma.http://link.springer.com/article/10.1186/s12931-018-0893-xAsthmaAirway inflammationProstaglandin D2Prostaglandin D2 receptor 2 |
| spellingShingle | Christian Domingo Oscar Palomares David A. Sandham Veit J. Erpenbeck Pablo Altman The prostaglandin D2 receptor 2 pathway in asthma: a key player in airway inflammation Respiratory Research Asthma Airway inflammation Prostaglandin D2 Prostaglandin D2 receptor 2 |
| title | The prostaglandin D2 receptor 2 pathway in asthma: a key player in airway inflammation |
| title_full | The prostaglandin D2 receptor 2 pathway in asthma: a key player in airway inflammation |
| title_fullStr | The prostaglandin D2 receptor 2 pathway in asthma: a key player in airway inflammation |
| title_full_unstemmed | The prostaglandin D2 receptor 2 pathway in asthma: a key player in airway inflammation |
| title_short | The prostaglandin D2 receptor 2 pathway in asthma: a key player in airway inflammation |
| title_sort | prostaglandin d2 receptor 2 pathway in asthma a key player in airway inflammation |
| topic | Asthma Airway inflammation Prostaglandin D2 Prostaglandin D2 receptor 2 |
| url | http://link.springer.com/article/10.1186/s12931-018-0893-x |
| work_keys_str_mv | AT christiandomingo theprostaglandind2receptor2pathwayinasthmaakeyplayerinairwayinflammation AT oscarpalomares theprostaglandind2receptor2pathwayinasthmaakeyplayerinairwayinflammation AT davidasandham theprostaglandind2receptor2pathwayinasthmaakeyplayerinairwayinflammation AT veitjerpenbeck theprostaglandind2receptor2pathwayinasthmaakeyplayerinairwayinflammation AT pabloaltman theprostaglandind2receptor2pathwayinasthmaakeyplayerinairwayinflammation AT christiandomingo prostaglandind2receptor2pathwayinasthmaakeyplayerinairwayinflammation AT oscarpalomares prostaglandind2receptor2pathwayinasthmaakeyplayerinairwayinflammation AT davidasandham prostaglandind2receptor2pathwayinasthmaakeyplayerinairwayinflammation AT veitjerpenbeck prostaglandind2receptor2pathwayinasthmaakeyplayerinairwayinflammation AT pabloaltman prostaglandind2receptor2pathwayinasthmaakeyplayerinairwayinflammation |