A high efficacy DNA vaccine against Tilapia lake virus in Nile tilapia (Oreochromis niloticus)
Tilapia lake virus (TiLV) is the main tilapia-infecting virus worldwide, causing serious economic losses to the tilapia aquaculture. However, there is no vaccine for this viral disease. Here, TiLV ORF10 (TiLV-ORF10) encoding a protein with abundant epitopes was cloned into the eukaryotic expression...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Elsevier
2022-06-01
|
| Series: | Aquaculture Reports |
| Subjects: | |
| Online Access: | http://www.sciencedirect.com/science/article/pii/S2352513422001624 |
| _version_ | 1817977391687925760 |
|---|---|
| author | Nai-tong Yu Wei-wei Zeng Zhongguo Xiong Zhi-xin Liu |
| author_facet | Nai-tong Yu Wei-wei Zeng Zhongguo Xiong Zhi-xin Liu |
| author_sort | Nai-tong Yu |
| collection | DOAJ |
| description | Tilapia lake virus (TiLV) is the main tilapia-infecting virus worldwide, causing serious economic losses to the tilapia aquaculture. However, there is no vaccine for this viral disease. Here, TiLV ORF10 (TiLV-ORF10) encoding a protein with abundant epitopes was cloned into the eukaryotic expression vector pcDNA3.1 as a vaccine candidate, and then used to evaluate the protective effects against TiLV in Nile tilapia (Oreochromis niloticus). RT-PCR and Western blot analyses confirmed pcDNA3.1–ORF10 expression in tilapia. The transcription levels of immunity-related genes such as immunoglobulin M, Toll-like receptor 2, myeloid differentiation factor 88, interleukin 8, tumor necrosis factor alpha, gamma-IFN, and nuclear factor κB were significantly upregulated in the spleen, liver, and kidney of the vaccinated tilapias (P < 0.05). TiLV challenge experiments showed that relative percent survival (RPS) was significantly enhanced in fish vaccinated with the DNA vaccine. Moreover, the RPS was significantly higher in fish vaccinated with a high dose of the DNA vaccine (85.72% RPS at a dosage of 45 μg DNA vaccine plasmid). Meanwhile, vaccination with pcDNA3.1–ORF10 significantly reduced virus replication, as evidenced by the lower amount of virus in the spleen, liver, and kidney of vaccinated tilapia than tilapias vaccinated with the empty pcDNA3.1 plasmid. Thus, pcDNA3.1–ORF10 could induce protective immunity in tilapia and may be a potential vaccine candidate for controlling disease caused by TiLV. |
| first_indexed | 2024-04-13T22:15:48Z |
| format | Article |
| id | doaj.art-aab108fe02cc4f2db9eed535387b831b |
| institution | Directory Open Access Journal |
| issn | 2352-5134 |
| language | English |
| last_indexed | 2024-04-13T22:15:48Z |
| publishDate | 2022-06-01 |
| publisher | Elsevier |
| record_format | Article |
| series | Aquaculture Reports |
| spelling | doaj.art-aab108fe02cc4f2db9eed535387b831b2022-12-22T02:27:33ZengElsevierAquaculture Reports2352-51342022-06-0124101166A high efficacy DNA vaccine against Tilapia lake virus in Nile tilapia (Oreochromis niloticus)Nai-tong Yu0Wei-wei Zeng1Zhongguo Xiong2Zhi-xin Liu3Key Laboratory of Biology and Genetic Resources of Tropical Crops, Ministry of Agriculture and Rural Affairs, Institute of Tropical Bioscience and Biotechnology, Chinese Academy of Tropical Agricultural Sciences, Haikou 571101, China; Hainan Key Laboratory of Tropical Microbe Resources, Haikou 571101, China; Corresponding author at: Key Laboratory of Biology and Genetic Resources of Tropical Crops, Ministry of Agriculture and Rural Affairs, Institute of Tropical Bioscience and Biotechnology, Chinese Academy of Tropical Agricultural Sciences, Haikou 571101, China.Guangdong Provincial Key Laboratory of Animal Molecular Design and Precise Breeding, Key Laboratory of Animal Molecular Design and Precise Breeding of Guangdong Higher Education Institutes, School of Life Science and Engineering, Foshan University, Foshan 528231, ChinaSchool of Plant Sciences and BIO5 Institute, University of Arizona, Tucson, AZ 85721, USAKey Laboratory of Biology and Genetic Resources of Tropical Crops, Ministry of Agriculture and Rural Affairs, Institute of Tropical Bioscience and Biotechnology, Chinese Academy of Tropical Agricultural Sciences, Haikou 571101, China; Hainan Academy of Tropical Agricultural Resource, Haikou 571101, ChinaTilapia lake virus (TiLV) is the main tilapia-infecting virus worldwide, causing serious economic losses to the tilapia aquaculture. However, there is no vaccine for this viral disease. Here, TiLV ORF10 (TiLV-ORF10) encoding a protein with abundant epitopes was cloned into the eukaryotic expression vector pcDNA3.1 as a vaccine candidate, and then used to evaluate the protective effects against TiLV in Nile tilapia (Oreochromis niloticus). RT-PCR and Western blot analyses confirmed pcDNA3.1–ORF10 expression in tilapia. The transcription levels of immunity-related genes such as immunoglobulin M, Toll-like receptor 2, myeloid differentiation factor 88, interleukin 8, tumor necrosis factor alpha, gamma-IFN, and nuclear factor κB were significantly upregulated in the spleen, liver, and kidney of the vaccinated tilapias (P < 0.05). TiLV challenge experiments showed that relative percent survival (RPS) was significantly enhanced in fish vaccinated with the DNA vaccine. Moreover, the RPS was significantly higher in fish vaccinated with a high dose of the DNA vaccine (85.72% RPS at a dosage of 45 μg DNA vaccine plasmid). Meanwhile, vaccination with pcDNA3.1–ORF10 significantly reduced virus replication, as evidenced by the lower amount of virus in the spleen, liver, and kidney of vaccinated tilapia than tilapias vaccinated with the empty pcDNA3.1 plasmid. Thus, pcDNA3.1–ORF10 could induce protective immunity in tilapia and may be a potential vaccine candidate for controlling disease caused by TiLV.http://www.sciencedirect.com/science/article/pii/S2352513422001624TilapiaNegative-sense RNA virusTilapia lake virusDNA vaccineTiLV ORF10 |
| spellingShingle | Nai-tong Yu Wei-wei Zeng Zhongguo Xiong Zhi-xin Liu A high efficacy DNA vaccine against Tilapia lake virus in Nile tilapia (Oreochromis niloticus) Aquaculture Reports Tilapia Negative-sense RNA virus Tilapia lake virus DNA vaccine TiLV ORF10 |
| title | A high efficacy DNA vaccine against Tilapia lake virus in Nile tilapia (Oreochromis niloticus) |
| title_full | A high efficacy DNA vaccine against Tilapia lake virus in Nile tilapia (Oreochromis niloticus) |
| title_fullStr | A high efficacy DNA vaccine against Tilapia lake virus in Nile tilapia (Oreochromis niloticus) |
| title_full_unstemmed | A high efficacy DNA vaccine against Tilapia lake virus in Nile tilapia (Oreochromis niloticus) |
| title_short | A high efficacy DNA vaccine against Tilapia lake virus in Nile tilapia (Oreochromis niloticus) |
| title_sort | high efficacy dna vaccine against tilapia lake virus in nile tilapia oreochromis niloticus |
| topic | Tilapia Negative-sense RNA virus Tilapia lake virus DNA vaccine TiLV ORF10 |
| url | http://www.sciencedirect.com/science/article/pii/S2352513422001624 |
| work_keys_str_mv | AT naitongyu ahighefficacydnavaccineagainsttilapialakevirusinniletilapiaoreochromisniloticus AT weiweizeng ahighefficacydnavaccineagainsttilapialakevirusinniletilapiaoreochromisniloticus AT zhongguoxiong ahighefficacydnavaccineagainsttilapialakevirusinniletilapiaoreochromisniloticus AT zhixinliu ahighefficacydnavaccineagainsttilapialakevirusinniletilapiaoreochromisniloticus AT naitongyu highefficacydnavaccineagainsttilapialakevirusinniletilapiaoreochromisniloticus AT weiweizeng highefficacydnavaccineagainsttilapialakevirusinniletilapiaoreochromisniloticus AT zhongguoxiong highefficacydnavaccineagainsttilapialakevirusinniletilapiaoreochromisniloticus AT zhixinliu highefficacydnavaccineagainsttilapialakevirusinniletilapiaoreochromisniloticus |