Effects of dietary inclusion of fish blood by-product from canning industry on growth and digestive enzyme activity in Pacific white shrimp, Litopenaeus vannamei (Boone, 1931)
Dry fish blood (DFB), a by-product from the fish processing industry, is a rich source of nutrients, small protein molecules and iron. This study aimed to examine the effects of dietary inclusion of canning by-product fish blood on growth performance and activity of digestive enzymes in L. vanname...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Prince of Songkla University
2018-04-01
|
| Series: | Songklanakarin Journal of Science and Technology (SJST) |
| Subjects: | |
| Online Access: | http://rdo.psu.ac.th/sjstweb/journal/40-2/40-2-19.pdf |
| _version_ | 1818486663165247488 |
|---|---|
| author | Nedrangsee Pranama Chutima Tantikitti Manee Srichanun Rutchanee Chotikachinda Teerapun Talee |
| author_facet | Nedrangsee Pranama Chutima Tantikitti Manee Srichanun Rutchanee Chotikachinda Teerapun Talee |
| author_sort | Nedrangsee Pranama |
| collection | DOAJ |
| description | Dry fish blood (DFB), a by-product from the fish processing industry, is a rich source of nutrients, small protein
molecules and iron. This study aimed to examine the effects of dietary inclusion of canning by-product fish blood on growth
performance and activity of digestive enzymes in L. vannamei with mean initial weight of 4.79±0.12 g. Six diets were
formulated: four diets having poultry meal and soybean meal as the main protein sources contained DFB at 0 (control), 4, 8, and
16% of diet and the reference diets5 and 6contained 4% tuna viscera hydrolysate (TVH) and 16% fish meal, respectively.
Triplicate groups of shrimp (12 shrimp tank-1
) were fed with respective diets five times daily for six weeks. The results showed
that growth of shrimp decreased with increasing level of dry fish blood. Growth performance of shrimp fed 4% DFB was not
significantly different from those fed 4% TVH. Survival rate was not significantly different among treatments (P>0.05). In
summary, dry fish blood could be used as a feed ingredient in shrimp diet at 4% of diet with good growth performance. The
results demonstrated that the high levels of dry fish blood had an effect on feed utilization efficiency, alkaline phosphatase
activity and shrimp growth reduction. |
| first_indexed | 2024-12-10T16:26:06Z |
| format | Article |
| id | doaj.art-aad6d1696a9840a6997853e7ff942237 |
| institution | Directory Open Access Journal |
| issn | 0125-3395 |
| language | English |
| last_indexed | 2024-12-10T16:26:06Z |
| publishDate | 2018-04-01 |
| publisher | Prince of Songkla University |
| record_format | Article |
| series | Songklanakarin Journal of Science and Technology (SJST) |
| spelling | doaj.art-aad6d1696a9840a6997853e7ff9422372022-12-22T01:41:39ZengPrince of Songkla UniversitySongklanakarin Journal of Science and Technology (SJST)0125-33952018-04-0140239039610.14456/sjst-psu.2018.38Effects of dietary inclusion of fish blood by-product from canning industry on growth and digestive enzyme activity in Pacific white shrimp, Litopenaeus vannamei (Boone, 1931)Nedrangsee Pranama0Chutima Tantikitti1Manee Srichanun2Rutchanee Chotikachinda3Teerapun Talee4Department of Aquatic Science, Faculty of Natural Resources, Prince of Songkla University, Hat Yai, Songkhla, 90112 ThailandDepartment of Aquatic Science, Faculty of Natural Resources, Prince of Songkla University, Hat Yai, Songkhla, 90112 ThailandDepartment of Aquatic Science, Faculty of Natural Resources, Prince of Songkla University, Hat Yai, Songkhla, 90112 ThailandDepartment of Aquatic Science, Faculty of Natural Resources, Prince of Songkla University, Hat Yai, Songkhla, 90112 ThailandDepartment of Aquatic Science, Faculty of Natural Resources, Prince of Songkla University, Hat Yai, Songkhla, 90112 ThailandDry fish blood (DFB), a by-product from the fish processing industry, is a rich source of nutrients, small protein molecules and iron. This study aimed to examine the effects of dietary inclusion of canning by-product fish blood on growth performance and activity of digestive enzymes in L. vannamei with mean initial weight of 4.79±0.12 g. Six diets were formulated: four diets having poultry meal and soybean meal as the main protein sources contained DFB at 0 (control), 4, 8, and 16% of diet and the reference diets5 and 6contained 4% tuna viscera hydrolysate (TVH) and 16% fish meal, respectively. Triplicate groups of shrimp (12 shrimp tank-1 ) were fed with respective diets five times daily for six weeks. The results showed that growth of shrimp decreased with increasing level of dry fish blood. Growth performance of shrimp fed 4% DFB was not significantly different from those fed 4% TVH. Survival rate was not significantly different among treatments (P>0.05). In summary, dry fish blood could be used as a feed ingredient in shrimp diet at 4% of diet with good growth performance. The results demonstrated that the high levels of dry fish blood had an effect on feed utilization efficiency, alkaline phosphatase activity and shrimp growth reduction.http://rdo.psu.ac.th/sjstweb/journal/40-2/40-2-19.pdfLitopenaeus vannameidry fish bloodfish meal replacementgrowthdigestive enzymes |
| spellingShingle | Nedrangsee Pranama Chutima Tantikitti Manee Srichanun Rutchanee Chotikachinda Teerapun Talee Effects of dietary inclusion of fish blood by-product from canning industry on growth and digestive enzyme activity in Pacific white shrimp, Litopenaeus vannamei (Boone, 1931) Songklanakarin Journal of Science and Technology (SJST) Litopenaeus vannamei dry fish blood fish meal replacement growth digestive enzymes |
| title | Effects of dietary inclusion of fish blood by-product from canning industry on growth and digestive enzyme activity in Pacific white shrimp, Litopenaeus vannamei (Boone, 1931) |
| title_full | Effects of dietary inclusion of fish blood by-product from canning industry on growth and digestive enzyme activity in Pacific white shrimp, Litopenaeus vannamei (Boone, 1931) |
| title_fullStr | Effects of dietary inclusion of fish blood by-product from canning industry on growth and digestive enzyme activity in Pacific white shrimp, Litopenaeus vannamei (Boone, 1931) |
| title_full_unstemmed | Effects of dietary inclusion of fish blood by-product from canning industry on growth and digestive enzyme activity in Pacific white shrimp, Litopenaeus vannamei (Boone, 1931) |
| title_short | Effects of dietary inclusion of fish blood by-product from canning industry on growth and digestive enzyme activity in Pacific white shrimp, Litopenaeus vannamei (Boone, 1931) |
| title_sort | effects of dietary inclusion of fish blood by product from canning industry on growth and digestive enzyme activity in pacific white shrimp litopenaeus vannamei boone 1931 |
| topic | Litopenaeus vannamei dry fish blood fish meal replacement growth digestive enzymes |
| url | http://rdo.psu.ac.th/sjstweb/journal/40-2/40-2-19.pdf |
| work_keys_str_mv | AT nedrangseepranama effectsofdietaryinclusionoffishbloodbyproductfromcanningindustryongrowthanddigestiveenzymeactivityinpacificwhiteshrimplitopenaeusvannameiboone1931 AT chutimatantikitti effectsofdietaryinclusionoffishbloodbyproductfromcanningindustryongrowthanddigestiveenzymeactivityinpacificwhiteshrimplitopenaeusvannameiboone1931 AT maneesrichanun effectsofdietaryinclusionoffishbloodbyproductfromcanningindustryongrowthanddigestiveenzymeactivityinpacificwhiteshrimplitopenaeusvannameiboone1931 AT rutchaneechotikachinda effectsofdietaryinclusionoffishbloodbyproductfromcanningindustryongrowthanddigestiveenzymeactivityinpacificwhiteshrimplitopenaeusvannameiboone1931 AT teerapuntalee effectsofdietaryinclusionoffishbloodbyproductfromcanningindustryongrowthanddigestiveenzymeactivityinpacificwhiteshrimplitopenaeusvannameiboone1931 |