The prophylactic treatment of Egyptian, Trigonella foenum - graecum L., Extract in comparison to pure diosgenin on experimentally induced non-alcoholic steatohepatitis: New targets via AMPK, RAR, and FXR pathways
Background: Non-alcoholic steatohepatitis (NASH) is an inflammatory liver condition that damages the liver by accumulating fat. Aim: Our study sought to explore the mechanisms involved through which fengreek, Trigonella foenum - graecum L., extract (FE) or diosgenin (DSG) exerted their hepatoprotect...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Elsevier
2023-05-01
|
| Series: | Phytomedicine Plus |
| Subjects: | |
| Online Access: | http://www.sciencedirect.com/science/article/pii/S2667031323000179 |
| _version_ | 1797829504581763072 |
|---|---|
| author | Manar M. Eltamalawy A.F. Abdel-Aziz Tarek M. Mohamed Naglaa F. Khedr |
| author_facet | Manar M. Eltamalawy A.F. Abdel-Aziz Tarek M. Mohamed Naglaa F. Khedr |
| author_sort | Manar M. Eltamalawy |
| collection | DOAJ |
| description | Background: Non-alcoholic steatohepatitis (NASH) is an inflammatory liver condition that damages the liver by accumulating fat. Aim: Our study sought to explore the mechanisms involved through which fengreek, Trigonella foenum - graecum L., extract (FE) or diosgenin (DSG) exerted their hepatoprotective activity in NASH-induced rat model. Methods: FE was prepared via a Soxhlet extraction, followed by acid hydrolysis. Sixty male albino rats were randomly distributed into six groups: normal control (NC) group, NASH-control group, FE group, low DSG dose (LD-1) group, medium DSG dose (MD-5) group, and high DSG dose (HD-10) group. The influence of both FE and pure DSG on serum liver indices, lipid profile, glucose, insulin, and Homeostasis model assessment (HOMA) of insulin resistance (IR) were determined. Liver histopathology, liver gene expression of adenosine monophosphate (AMP)-activated protein kinase (AMPK), Farnesoid X receptor (FXR) and retinoic acid receptor (RAR), and protein expression of phospho-acetyl CoA carboxylase (p-ACC) were evaluated. Results: A significant amelioration was noticed in serum liver indices, lipid profile, liver histopathology, body weight gain, and p-ACC/ACC protein expression in both FE and DSG treated groups compared to the NASH untreated group. DSG-treated groups significantly (p<0.05) decreased serum glucose levels and HOMA-IR compared to the NASH untreated group. FE significantly upregulated AMPK compared to the NASH untreated group and DSG-treated groups. However, RAR downregulation and FXR overexpression of the NASH group were not normalized in treated groups. Conclusion: This study proved that FE and DSG both protected the liver against NASH. The DSG impact was dose-dependent. However, the activation of the AMPK cascade was believed to be the mechanism by which FE exerted its hepatoprotective effects. |
| first_indexed | 2024-04-09T13:22:17Z |
| format | Article |
| id | doaj.art-aadf16f2a32d4b0d816a9aab698dba2b |
| institution | Directory Open Access Journal |
| issn | 2667-0313 |
| language | English |
| last_indexed | 2024-04-09T13:22:17Z |
| publishDate | 2023-05-01 |
| publisher | Elsevier |
| record_format | Article |
| series | Phytomedicine Plus |
| spelling | doaj.art-aadf16f2a32d4b0d816a9aab698dba2b2023-05-11T04:24:50ZengElsevierPhytomedicine Plus2667-03132023-05-0132100421The prophylactic treatment of Egyptian, Trigonella foenum - graecum L., Extract in comparison to pure diosgenin on experimentally induced non-alcoholic steatohepatitis: New targets via AMPK, RAR, and FXR pathwaysManar M. Eltamalawy0A.F. Abdel-Aziz1Tarek M. Mohamed2Naglaa F. Khedr3Biochemistry Unit, Chemistry Department, Faculty of Science, Mansoura University, Mansoura, Postal code: 35516, Egypt; Corresponding author.Biochemistry Unit, Chemistry Department, Faculty of Science, Mansoura University, Mansoura, Postal code: 35516, EgyptBiochemistry Unit, Chemistry Department, Faculty of Science, Tanta University, Tanta, Postal code: 31527, EgyptBiochemistry Department, Faculty of Pharmacy, Tanta University, Tanta, Postal code: 31527, EgyptBackground: Non-alcoholic steatohepatitis (NASH) is an inflammatory liver condition that damages the liver by accumulating fat. Aim: Our study sought to explore the mechanisms involved through which fengreek, Trigonella foenum - graecum L., extract (FE) or diosgenin (DSG) exerted their hepatoprotective activity in NASH-induced rat model. Methods: FE was prepared via a Soxhlet extraction, followed by acid hydrolysis. Sixty male albino rats were randomly distributed into six groups: normal control (NC) group, NASH-control group, FE group, low DSG dose (LD-1) group, medium DSG dose (MD-5) group, and high DSG dose (HD-10) group. The influence of both FE and pure DSG on serum liver indices, lipid profile, glucose, insulin, and Homeostasis model assessment (HOMA) of insulin resistance (IR) were determined. Liver histopathology, liver gene expression of adenosine monophosphate (AMP)-activated protein kinase (AMPK), Farnesoid X receptor (FXR) and retinoic acid receptor (RAR), and protein expression of phospho-acetyl CoA carboxylase (p-ACC) were evaluated. Results: A significant amelioration was noticed in serum liver indices, lipid profile, liver histopathology, body weight gain, and p-ACC/ACC protein expression in both FE and DSG treated groups compared to the NASH untreated group. DSG-treated groups significantly (p<0.05) decreased serum glucose levels and HOMA-IR compared to the NASH untreated group. FE significantly upregulated AMPK compared to the NASH untreated group and DSG-treated groups. However, RAR downregulation and FXR overexpression of the NASH group were not normalized in treated groups. Conclusion: This study proved that FE and DSG both protected the liver against NASH. The DSG impact was dose-dependent. However, the activation of the AMPK cascade was believed to be the mechanism by which FE exerted its hepatoprotective effects.http://www.sciencedirect.com/science/article/pii/S2667031323000179Acetyl-CoA carboxylaseDiosgeninFarnesoid X receptorFenugreekNon-alcoholic steatohepatitisRetinoic acid receptor |
| spellingShingle | Manar M. Eltamalawy A.F. Abdel-Aziz Tarek M. Mohamed Naglaa F. Khedr The prophylactic treatment of Egyptian, Trigonella foenum - graecum L., Extract in comparison to pure diosgenin on experimentally induced non-alcoholic steatohepatitis: New targets via AMPK, RAR, and FXR pathways Phytomedicine Plus Acetyl-CoA carboxylase Diosgenin Farnesoid X receptor Fenugreek Non-alcoholic steatohepatitis Retinoic acid receptor |
| title | The prophylactic treatment of Egyptian, Trigonella foenum - graecum L., Extract in comparison to pure diosgenin on experimentally induced non-alcoholic steatohepatitis: New targets via AMPK, RAR, and FXR pathways |
| title_full | The prophylactic treatment of Egyptian, Trigonella foenum - graecum L., Extract in comparison to pure diosgenin on experimentally induced non-alcoholic steatohepatitis: New targets via AMPK, RAR, and FXR pathways |
| title_fullStr | The prophylactic treatment of Egyptian, Trigonella foenum - graecum L., Extract in comparison to pure diosgenin on experimentally induced non-alcoholic steatohepatitis: New targets via AMPK, RAR, and FXR pathways |
| title_full_unstemmed | The prophylactic treatment of Egyptian, Trigonella foenum - graecum L., Extract in comparison to pure diosgenin on experimentally induced non-alcoholic steatohepatitis: New targets via AMPK, RAR, and FXR pathways |
| title_short | The prophylactic treatment of Egyptian, Trigonella foenum - graecum L., Extract in comparison to pure diosgenin on experimentally induced non-alcoholic steatohepatitis: New targets via AMPK, RAR, and FXR pathways |
| title_sort | prophylactic treatment of egyptian trigonella foenum graecum l extract in comparison to pure diosgenin on experimentally induced non alcoholic steatohepatitis new targets via ampk rar and fxr pathways |
| topic | Acetyl-CoA carboxylase Diosgenin Farnesoid X receptor Fenugreek Non-alcoholic steatohepatitis Retinoic acid receptor |
| url | http://www.sciencedirect.com/science/article/pii/S2667031323000179 |
| work_keys_str_mv | AT manarmeltamalawy theprophylactictreatmentofegyptiantrigonellafoenumgraecumlextractincomparisontopurediosgeninonexperimentallyinducednonalcoholicsteatohepatitisnewtargetsviaampkrarandfxrpathways AT afabdelaziz theprophylactictreatmentofegyptiantrigonellafoenumgraecumlextractincomparisontopurediosgeninonexperimentallyinducednonalcoholicsteatohepatitisnewtargetsviaampkrarandfxrpathways AT tarekmmohamed theprophylactictreatmentofegyptiantrigonellafoenumgraecumlextractincomparisontopurediosgeninonexperimentallyinducednonalcoholicsteatohepatitisnewtargetsviaampkrarandfxrpathways AT naglaafkhedr theprophylactictreatmentofegyptiantrigonellafoenumgraecumlextractincomparisontopurediosgeninonexperimentallyinducednonalcoholicsteatohepatitisnewtargetsviaampkrarandfxrpathways AT manarmeltamalawy prophylactictreatmentofegyptiantrigonellafoenumgraecumlextractincomparisontopurediosgeninonexperimentallyinducednonalcoholicsteatohepatitisnewtargetsviaampkrarandfxrpathways AT afabdelaziz prophylactictreatmentofegyptiantrigonellafoenumgraecumlextractincomparisontopurediosgeninonexperimentallyinducednonalcoholicsteatohepatitisnewtargetsviaampkrarandfxrpathways AT tarekmmohamed prophylactictreatmentofegyptiantrigonellafoenumgraecumlextractincomparisontopurediosgeninonexperimentallyinducednonalcoholicsteatohepatitisnewtargetsviaampkrarandfxrpathways AT naglaafkhedr prophylactictreatmentofegyptiantrigonellafoenumgraecumlextractincomparisontopurediosgeninonexperimentallyinducednonalcoholicsteatohepatitisnewtargetsviaampkrarandfxrpathways |