Publisher Correction: RAPP-containing arrest peptides induce translational stalling by short circuiting the ribosomal peptidyltransferase activity
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Nature Portfolio
2024-04-01
|
| Series: | Nature Communications |
| Online Access: | https://doi.org/10.1038/s41467-024-47508-w |
| _version_ | 1797199352311054336 |
|---|---|
| author | Martino Morici Sara Gabrielli Keigo Fujiwara Helge Paternoga Bertrand Beckert Lars V. Bock Shinobu Chiba Daniel N. Wilson |
| author_facet | Martino Morici Sara Gabrielli Keigo Fujiwara Helge Paternoga Bertrand Beckert Lars V. Bock Shinobu Chiba Daniel N. Wilson |
| author_sort | Martino Morici |
| collection | DOAJ |
| first_indexed | 2024-04-24T07:14:23Z |
| format | Article |
| id | doaj.art-afb6c7fda3c64b749bca30d8bbbdb214 |
| institution | Directory Open Access Journal |
| issn | 2041-1723 |
| language | English |
| last_indexed | 2024-04-24T07:14:23Z |
| publishDate | 2024-04-01 |
| publisher | Nature Portfolio |
| record_format | Article |
| series | Nature Communications |
| spelling | doaj.art-afb6c7fda3c64b749bca30d8bbbdb2142024-04-21T11:23:51ZengNature PortfolioNature Communications2041-17232024-04-011511110.1038/s41467-024-47508-wPublisher Correction: RAPP-containing arrest peptides induce translational stalling by short circuiting the ribosomal peptidyltransferase activityMartino Morici0Sara Gabrielli1Keigo Fujiwara2Helge Paternoga3Bertrand Beckert4Lars V. Bock5Shinobu Chiba6Daniel N. Wilson7Institute for Biochemistry and Molecular Biology, University of HamburgTheoretical and Computational Biophysics Department, Max Planck Institute for Multidisciplinary SciencesFaculty of Life Sciences and Institute for Protein Dynamics, Kyoto Sangyo UniversityInstitute for Biochemistry and Molecular Biology, University of HamburgInstitute for Biochemistry and Molecular Biology, University of HamburgTheoretical and Computational Biophysics Department, Max Planck Institute for Multidisciplinary SciencesFaculty of Life Sciences and Institute for Protein Dynamics, Kyoto Sangyo UniversityInstitute for Biochemistry and Molecular Biology, University of Hamburghttps://doi.org/10.1038/s41467-024-47508-w |
| spellingShingle | Martino Morici Sara Gabrielli Keigo Fujiwara Helge Paternoga Bertrand Beckert Lars V. Bock Shinobu Chiba Daniel N. Wilson Publisher Correction: RAPP-containing arrest peptides induce translational stalling by short circuiting the ribosomal peptidyltransferase activity Nature Communications |
| title | Publisher Correction: RAPP-containing arrest peptides induce translational stalling by short circuiting the ribosomal peptidyltransferase activity |
| title_full | Publisher Correction: RAPP-containing arrest peptides induce translational stalling by short circuiting the ribosomal peptidyltransferase activity |
| title_fullStr | Publisher Correction: RAPP-containing arrest peptides induce translational stalling by short circuiting the ribosomal peptidyltransferase activity |
| title_full_unstemmed | Publisher Correction: RAPP-containing arrest peptides induce translational stalling by short circuiting the ribosomal peptidyltransferase activity |
| title_short | Publisher Correction: RAPP-containing arrest peptides induce translational stalling by short circuiting the ribosomal peptidyltransferase activity |
| title_sort | publisher correction rapp containing arrest peptides induce translational stalling by short circuiting the ribosomal peptidyltransferase activity |
| url | https://doi.org/10.1038/s41467-024-47508-w |
| work_keys_str_mv | AT martinomorici publishercorrectionrappcontainingarrestpeptidesinducetranslationalstallingbyshortcircuitingtheribosomalpeptidyltransferaseactivity AT saragabrielli publishercorrectionrappcontainingarrestpeptidesinducetranslationalstallingbyshortcircuitingtheribosomalpeptidyltransferaseactivity AT keigofujiwara publishercorrectionrappcontainingarrestpeptidesinducetranslationalstallingbyshortcircuitingtheribosomalpeptidyltransferaseactivity AT helgepaternoga publishercorrectionrappcontainingarrestpeptidesinducetranslationalstallingbyshortcircuitingtheribosomalpeptidyltransferaseactivity AT bertrandbeckert publishercorrectionrappcontainingarrestpeptidesinducetranslationalstallingbyshortcircuitingtheribosomalpeptidyltransferaseactivity AT larsvbock publishercorrectionrappcontainingarrestpeptidesinducetranslationalstallingbyshortcircuitingtheribosomalpeptidyltransferaseactivity AT shinobuchiba publishercorrectionrappcontainingarrestpeptidesinducetranslationalstallingbyshortcircuitingtheribosomalpeptidyltransferaseactivity AT danielnwilson publishercorrectionrappcontainingarrestpeptidesinducetranslationalstallingbyshortcircuitingtheribosomalpeptidyltransferaseactivity |