Effect of pawpaw (<em>Carica papaya</em>) leaf meal and dietary enzymes on broiler performance, digestibility, carcass and blood composition
Exogenous enzymes and phytogenic feed additives are proposed as alternatives to antibiotic growth promoters in poultry production. This study assessed the effect of pawpaw leaf meal (PLM) inclusion and enzyme (E) supplementation in the diet of broiler chickens. In total 288 Arbor-Acre day-old broil...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
CIRAD
2018-10-01
|
| Series: | Revue d’Elevage et de Médecine Vétérinaire des Pays Tropicaux |
| Subjects: | |
| Online Access: | https://revues.cirad.fr/index.php/REMVT/article/view/31640 |
| _version_ | 1797697837827358720 |
|---|---|
| author | Olugbenga David Oloruntola Simeon Olugbenga Ayodele Deborah Adebukola Oloruntola |
| author_facet | Olugbenga David Oloruntola Simeon Olugbenga Ayodele Deborah Adebukola Oloruntola |
| author_sort | Olugbenga David Oloruntola |
| collection | DOAJ |
| description |
Exogenous enzymes and phytogenic feed additives are proposed as alternatives to antibiotic growth promoters in poultry production. This study assessed the effect of pawpaw leaf meal (PLM) inclusion and enzyme (E) supplementation in the diet of broiler chickens. In total 288 Arbor-Acre day-old broiler chickens were used. Four diets were formulated to be isocaloric and isonitrogenous: diet 1, control (0% PLM, 0% E), diet 2 (0% PLM, 0.05% E), diet 3 (5% PLM, 0% E), and diet 4 (5% PLM, 0.05% E). Each diet was replicated six times with 12 chickens in each batch. E improved (p < 0.05) the body weight gain at three weeks. The dry matter (DM), crude protein (CP), ether extract and ash digestibility were improved (p < 0.05) with E, whereas PLM inclusion produced (p < 0.05) an increase in DM and CP digestibility. The E x PLM effect was significant (p < 0.05) for DM and CP digestibility. E improved (p < 0.05) the slaughter weight and reduced the liver weight. Platelets varied across diets and increased (p < 0.05) with enzyme supplementation. E reduced (p < 0.05) low-density lipoproteins (LDL), whereas PLM reduced (p < 0.05) cholesterol and LDL. In conclusion, the association of E and PLM improved chicken growth, and E or PLM inclusion should benefit chicken health.
|
| first_indexed | 2024-03-12T03:45:48Z |
| format | Article |
| id | doaj.art-b4160a17efbe474fbc3f2e46b26381bf |
| institution | Directory Open Access Journal |
| issn | 0035-1865 1951-6711 |
| language | English |
| last_indexed | 2024-03-12T03:45:48Z |
| publishDate | 2018-10-01 |
| publisher | CIRAD |
| record_format | Article |
| series | Revue d’Elevage et de Médecine Vétérinaire des Pays Tropicaux |
| spelling | doaj.art-b4160a17efbe474fbc3f2e46b26381bf2023-09-03T12:57:42ZengCIRADRevue d’Elevage et de Médecine Vétérinaire des Pays Tropicaux0035-18651951-67112018-10-0171310.19182/remvt.3164031469Effect of pawpaw (<em>Carica papaya</em>) leaf meal and dietary enzymes on broiler performance, digestibility, carcass and blood compositionOlugbenga David Oloruntola0Simeon Olugbenga Ayodele1Deborah Adebukola Oloruntola21. Animal Science Department, Adekunle Ajasin University, Akungba Akoko, Nigeria. 2. Department of Agricultural Technology, The Federal Polytechnic, Ado Ekiti, Nigeria.Department of Agricultural Technology, The Federal Polytechnic, Ado Ekiti, NigeriaDepartment of Microbiology, The Federal University of Technology, Akure, Nigeria Exogenous enzymes and phytogenic feed additives are proposed as alternatives to antibiotic growth promoters in poultry production. This study assessed the effect of pawpaw leaf meal (PLM) inclusion and enzyme (E) supplementation in the diet of broiler chickens. In total 288 Arbor-Acre day-old broiler chickens were used. Four diets were formulated to be isocaloric and isonitrogenous: diet 1, control (0% PLM, 0% E), diet 2 (0% PLM, 0.05% E), diet 3 (5% PLM, 0% E), and diet 4 (5% PLM, 0.05% E). Each diet was replicated six times with 12 chickens in each batch. E improved (p < 0.05) the body weight gain at three weeks. The dry matter (DM), crude protein (CP), ether extract and ash digestibility were improved (p < 0.05) with E, whereas PLM inclusion produced (p < 0.05) an increase in DM and CP digestibility. The E x PLM effect was significant (p < 0.05) for DM and CP digestibility. E improved (p < 0.05) the slaughter weight and reduced the liver weight. Platelets varied across diets and increased (p < 0.05) with enzyme supplementation. E reduced (p < 0.05) low-density lipoproteins (LDL), whereas PLM reduced (p < 0.05) cholesterol and LDL. In conclusion, the association of E and PLM improved chicken growth, and E or PLM inclusion should benefit chicken health. https://revues.cirad.fr/index.php/REMVT/article/view/31640broiler chickensanimal feedingpapayasenzymesanimal performanceNigeria |
| spellingShingle | Olugbenga David Oloruntola Simeon Olugbenga Ayodele Deborah Adebukola Oloruntola Effect of pawpaw (<em>Carica papaya</em>) leaf meal and dietary enzymes on broiler performance, digestibility, carcass and blood composition Revue d’Elevage et de Médecine Vétérinaire des Pays Tropicaux broiler chickens animal feeding papayas enzymes animal performance Nigeria |
| title | Effect of pawpaw (<em>Carica papaya</em>) leaf meal and dietary enzymes on broiler performance, digestibility, carcass and blood composition |
| title_full | Effect of pawpaw (<em>Carica papaya</em>) leaf meal and dietary enzymes on broiler performance, digestibility, carcass and blood composition |
| title_fullStr | Effect of pawpaw (<em>Carica papaya</em>) leaf meal and dietary enzymes on broiler performance, digestibility, carcass and blood composition |
| title_full_unstemmed | Effect of pawpaw (<em>Carica papaya</em>) leaf meal and dietary enzymes on broiler performance, digestibility, carcass and blood composition |
| title_short | Effect of pawpaw (<em>Carica papaya</em>) leaf meal and dietary enzymes on broiler performance, digestibility, carcass and blood composition |
| title_sort | effect of pawpaw em carica papaya em leaf meal and dietary enzymes on broiler performance digestibility carcass and blood composition |
| topic | broiler chickens animal feeding papayas enzymes animal performance Nigeria |
| url | https://revues.cirad.fr/index.php/REMVT/article/view/31640 |
| work_keys_str_mv | AT olugbengadavidoloruntola effectofpawpawemcaricapapayaemleafmealanddietaryenzymesonbroilerperformancedigestibilitycarcassandbloodcomposition AT simeonolugbengaayodele effectofpawpawemcaricapapayaemleafmealanddietaryenzymesonbroilerperformancedigestibilitycarcassandbloodcomposition AT deborahadebukolaoloruntola effectofpawpawemcaricapapayaemleafmealanddietaryenzymesonbroilerperformancedigestibilitycarcassandbloodcomposition |