Bandgap tuning of TiO2 by Cu nanoparticles applied in photocatalytic antifouling-coated PES membranes through PAA-plasma grafted adhesive layer
This study developed an antifouling coating for polyethersulfone (PES) membranes by tuning the bandgap of TiO2 with Cu nanoparticles (NPs) via a polyacrylic acid (PAA)-plasma-grafted intermediate layer. Cu NPs were synthesized at different molar ratios and precipitated onto TiO2 using the sol-gel me...
| Main Authors: | , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
IWA Publishing
2023-05-01
|
| Series: | Water Science and Technology |
| Subjects: | |
| Online Access: | http://wst.iwaponline.com/content/87/9/2390 |
| _version_ | 1797809043884998656 |
|---|---|
| author | Hieu Trung Nguyen Ha Manh Bui |
| author_facet | Hieu Trung Nguyen Ha Manh Bui |
| author_sort | Hieu Trung Nguyen |
| collection | DOAJ |
| description | This study developed an antifouling coating for polyethersulfone (PES) membranes by tuning the bandgap of TiO2 with Cu nanoparticles (NPs) via a polyacrylic acid (PAA)-plasma-grafted intermediate layer. Cu NPs were synthesized at different molar ratios and precipitated onto TiO2 using the sol-gel method. The resulting Cu@TiO2 photocatalysts were characterized using various techniques, showing reduced bandgap, particle size range of 100–200 nm, and generation of reactive free radicals under light irradiation. The 25% Cu@TiO2 photocatalyst displayed the highest catalytic efficiency for Acid Blue 260 (AB260) degradation, achieving 73% and 96% with and without H2O2, respectively. Photocatalytic membranes based on this catalyst achieved an AB260 degradation efficiency of 91% and remained stable over five cycles. Additionally, sodium alginate-fouled photocatalytic membranes fully recovered water permeability after undergoing photocatalytic degradation of foulants. The modified membrane displayed a higher surface roughness due to the presence of photocatalyst particles. This study demonstrates the potential application of Cu@TiO2/PAA/PES photocatalytic membranes for mitigating membrane fouling in practice.
HIGHLIGHTS
Bandgap tuning of TiO2 with Cu NPs successfully enhanced photocatalytic performance.;
Mechanism of photocatalytic decomposition of Acid Blue 260 attributed to •OH radicals.;
PAA plasma-grafting improved binding between PES membrane surface and photocatalyst.;
Cu@TiO2/PAA/PES membranes exhibited high water flux and FRR of 98%.; |
| first_indexed | 2024-03-13T06:46:39Z |
| format | Article |
| id | doaj.art-bf38040eecee4619908d66c47259ff7f |
| institution | Directory Open Access Journal |
| issn | 0273-1223 1996-9732 |
| language | English |
| last_indexed | 2024-03-13T06:46:39Z |
| publishDate | 2023-05-01 |
| publisher | IWA Publishing |
| record_format | Article |
| series | Water Science and Technology |
| spelling | doaj.art-bf38040eecee4619908d66c47259ff7f2023-06-08T05:54:13ZengIWA PublishingWater Science and Technology0273-12231996-97322023-05-018792390240510.2166/wst.2023.129129Bandgap tuning of TiO2 by Cu nanoparticles applied in photocatalytic antifouling-coated PES membranes through PAA-plasma grafted adhesive layerHieu Trung Nguyen0Ha Manh Bui1 Institute of Applied Technology, Thu Dau Mot University, 06 Tran Van On Street, Phu Hoa Ward, Thu Dau Mot City 750000, Binh Duong Province, Vietnam Faculty of Environment, Saigon University, 273 An Duong Vuong Street, District 5, Ho Chi Minh City 700000, Vietnam This study developed an antifouling coating for polyethersulfone (PES) membranes by tuning the bandgap of TiO2 with Cu nanoparticles (NPs) via a polyacrylic acid (PAA)-plasma-grafted intermediate layer. Cu NPs were synthesized at different molar ratios and precipitated onto TiO2 using the sol-gel method. The resulting Cu@TiO2 photocatalysts were characterized using various techniques, showing reduced bandgap, particle size range of 100–200 nm, and generation of reactive free radicals under light irradiation. The 25% Cu@TiO2 photocatalyst displayed the highest catalytic efficiency for Acid Blue 260 (AB260) degradation, achieving 73% and 96% with and without H2O2, respectively. Photocatalytic membranes based on this catalyst achieved an AB260 degradation efficiency of 91% and remained stable over five cycles. Additionally, sodium alginate-fouled photocatalytic membranes fully recovered water permeability after undergoing photocatalytic degradation of foulants. The modified membrane displayed a higher surface roughness due to the presence of photocatalyst particles. This study demonstrates the potential application of Cu@TiO2/PAA/PES photocatalytic membranes for mitigating membrane fouling in practice. HIGHLIGHTS Bandgap tuning of TiO2 with Cu NPs successfully enhanced photocatalytic performance.; Mechanism of photocatalytic decomposition of Acid Blue 260 attributed to •OH radicals.; PAA plasma-grafting improved binding between PES membrane surface and photocatalyst.; Cu@TiO2/PAA/PES membranes exhibited high water flux and FRR of 98%.;http://wst.iwaponline.com/content/87/9/2390antifouling photocatalytic membranescu@tio2 compositepaa graftingpes filtration membranesplasma |
| spellingShingle | Hieu Trung Nguyen Ha Manh Bui Bandgap tuning of TiO2 by Cu nanoparticles applied in photocatalytic antifouling-coated PES membranes through PAA-plasma grafted adhesive layer Water Science and Technology antifouling photocatalytic membranes cu@tio2 composite paa grafting pes filtration membranes plasma |
| title | Bandgap tuning of TiO2 by Cu nanoparticles applied in photocatalytic antifouling-coated PES membranes through PAA-plasma grafted adhesive layer |
| title_full | Bandgap tuning of TiO2 by Cu nanoparticles applied in photocatalytic antifouling-coated PES membranes through PAA-plasma grafted adhesive layer |
| title_fullStr | Bandgap tuning of TiO2 by Cu nanoparticles applied in photocatalytic antifouling-coated PES membranes through PAA-plasma grafted adhesive layer |
| title_full_unstemmed | Bandgap tuning of TiO2 by Cu nanoparticles applied in photocatalytic antifouling-coated PES membranes through PAA-plasma grafted adhesive layer |
| title_short | Bandgap tuning of TiO2 by Cu nanoparticles applied in photocatalytic antifouling-coated PES membranes through PAA-plasma grafted adhesive layer |
| title_sort | bandgap tuning of tio2 by cu nanoparticles applied in photocatalytic antifouling coated pes membranes through paa plasma grafted adhesive layer |
| topic | antifouling photocatalytic membranes cu@tio2 composite paa grafting pes filtration membranes plasma |
| url | http://wst.iwaponline.com/content/87/9/2390 |
| work_keys_str_mv | AT hieutrungnguyen bandgaptuningoftio2bycunanoparticlesappliedinphotocatalyticantifoulingcoatedpesmembranesthroughpaaplasmagraftedadhesivelayer AT hamanhbui bandgaptuningoftio2bycunanoparticlesappliedinphotocatalyticantifoulingcoatedpesmembranesthroughpaaplasmagraftedadhesivelayer |