Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China
Abstract We aimed to assess the prevalence of chronic kidney diseases (CKD) markers among the married residents with fertility desire in rural China. Demographic and clinical data were collected from the National Free Pre-Conception Health Examination Project. Estimated glomerular filtration rate (e...
| Main Authors: | , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Nature Portfolio
2017-06-01
|
| Series: | Scientific Reports |
| Online Access: | https://doi.org/10.1038/s41598-017-02355-2 |
| _version_ | 1819127354171064320 |
|---|---|
| author | Ye Du Shikun Zhang Mei Hu Qiaomei Wang Haiping Shen Yiping Zhang Donghai Yan Yuanyuan Li Man Zhang Qun Meng |
| author_facet | Ye Du Shikun Zhang Mei Hu Qiaomei Wang Haiping Shen Yiping Zhang Donghai Yan Yuanyuan Li Man Zhang Qun Meng |
| author_sort | Ye Du |
| collection | DOAJ |
| description | Abstract We aimed to assess the prevalence of chronic kidney diseases (CKD) markers among the married residents with fertility desire in rural China. Demographic and clinical data were collected from the National Free Pre-Conception Health Examination Project. Estimated glomerular filtration rate (eGFR) < 60 mL/min//1.73 m2, proteinuria, and hematuria were defined as markers of CKD. GFR was evaluated by using serum creatinine level and the Asian-modified CKD epidemiology collaboration equation. Automated urine dry chemical and microscopic analyses were employed to identify proteinuria and hematuria. The prevalence of CKD markers was 2.92% in the 3,091,379 participants. eGFR < 60 mL/min//1.73 m2, hematuria and proteinuria was observed in 0.85%, 1.41% and 0.71%, respectively. The prevalence of CKD markers varied greatly across different geographical locations, which was the highest in the Eastern Region (3.86%; 95% confidence interval [CI]: 3.81–3.91%), moderate in the Central Region (2.80%; 95% CI: 2.77–2.82%), and lowest in the Western Region (2.62%; 95% CI: 2.59–2.65%). Hypertension, obesity, positive hepatitis B virus surface antigen (HBsAg), age (increased by every 5 years), female gender, and living area were potential risk factors for CKD. In rural China, the prevalence of CKD markers in the married couples with fertility desire is low. |
| first_indexed | 2024-12-22T08:10:35Z |
| format | Article |
| id | doaj.art-c24ba0c9ddd84a8aa513f1e01d006c7f |
| institution | Directory Open Access Journal |
| issn | 2045-2322 |
| language | English |
| last_indexed | 2024-12-22T08:10:35Z |
| publishDate | 2017-06-01 |
| publisher | Nature Portfolio |
| record_format | Article |
| series | Scientific Reports |
| spelling | doaj.art-c24ba0c9ddd84a8aa513f1e01d006c7f2022-12-21T18:33:02ZengNature PortfolioScientific Reports2045-23222017-06-01711910.1038/s41598-017-02355-2Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural ChinaYe Du0Shikun Zhang1Mei Hu2Qiaomei Wang3Haiping Shen4Yiping Zhang5Donghai Yan6Yuanyuan Li7Man Zhang8Qun Meng9Department of Social Medicine and Health Management, Public Health College, Harbin Medical UniversityDepartment of Maternal and Child Health, National Health and Family Planning Commission of the PRCDepartment of Clinical Laboratory, Beijing Shijitan Hospital, Capital Medical UniversityDepartment of Maternal and Child Health, National Health and Family Planning Commission of the PRCDepartment of Maternal and Child Health, National Health and Family Planning Commission of the PRCDepartment of Maternal and Child Health, National Health and Family Planning Commission of the PRCDepartment of Maternal and Child Health, National Health and Family Planning Commission of the PRCDepartment of Maternal and Child Health Research, National Research Institute for Family PlanningDepartment of Clinical Laboratory, Beijing Shijitan Hospital, Capital Medical UniversityDepartment of Social Medicine and Health Management, Public Health College, Harbin Medical UniversityAbstract We aimed to assess the prevalence of chronic kidney diseases (CKD) markers among the married residents with fertility desire in rural China. Demographic and clinical data were collected from the National Free Pre-Conception Health Examination Project. Estimated glomerular filtration rate (eGFR) < 60 mL/min//1.73 m2, proteinuria, and hematuria were defined as markers of CKD. GFR was evaluated by using serum creatinine level and the Asian-modified CKD epidemiology collaboration equation. Automated urine dry chemical and microscopic analyses were employed to identify proteinuria and hematuria. The prevalence of CKD markers was 2.92% in the 3,091,379 participants. eGFR < 60 mL/min//1.73 m2, hematuria and proteinuria was observed in 0.85%, 1.41% and 0.71%, respectively. The prevalence of CKD markers varied greatly across different geographical locations, which was the highest in the Eastern Region (3.86%; 95% confidence interval [CI]: 3.81–3.91%), moderate in the Central Region (2.80%; 95% CI: 2.77–2.82%), and lowest in the Western Region (2.62%; 95% CI: 2.59–2.65%). Hypertension, obesity, positive hepatitis B virus surface antigen (HBsAg), age (increased by every 5 years), female gender, and living area were potential risk factors for CKD. In rural China, the prevalence of CKD markers in the married couples with fertility desire is low.https://doi.org/10.1038/s41598-017-02355-2 |
| spellingShingle | Ye Du Shikun Zhang Mei Hu Qiaomei Wang Haiping Shen Yiping Zhang Donghai Yan Yuanyuan Li Man Zhang Qun Meng Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China Scientific Reports |
| title | Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
| title_full | Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
| title_fullStr | Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
| title_full_unstemmed | Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
| title_short | Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
| title_sort | prevalence of chronic kidney disease markers evidence from a three million married population with fertility desire in rural china |
| url | https://doi.org/10.1038/s41598-017-02355-2 |
| work_keys_str_mv | AT yedu prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT shikunzhang prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT meihu prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT qiaomeiwang prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT haipingshen prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT yipingzhang prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT donghaiyan prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT yuanyuanli prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT manzhang prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT qunmeng prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina |