Design and Mechanical Analysis of a Cam-Linked Planetary Gear System Seedling Picking Mechanism
This study designed a cam-linked planetary gear system automatic seedling picking mechanism to address unstable operation and issues of high damage to the substrate caused by the picking mechanism of the dryland vegetable seedling transplanter. Through an analysis of the kinematic principle of the s...
| Main Authors: | , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2023-03-01
|
| Series: | Agriculture |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2077-0472/13/4/810 |
| _version_ | 1797606882498576384 |
|---|---|
| author | Xin Jin Bo Zhang Hongbin Suo Cheng Lin Jiangtao Ji Xiaolin Xie |
| author_facet | Xin Jin Bo Zhang Hongbin Suo Cheng Lin Jiangtao Ji Xiaolin Xie |
| author_sort | Xin Jin |
| collection | DOAJ |
| description | This study designed a cam-linked planetary gear system automatic seedling picking mechanism to address unstable operation and issues of high damage to the substrate caused by the picking mechanism of the dryland vegetable seedling transplanter. Through an analysis of the kinematic principle of the structure and the establishment of the kinematic model, computer-aided analysis software was developed using Visual Basic 6.0. Consequently, a set of structural parameter values satisfying the target trajectory was derived employing the human–computer interaction method, and the 3D model was designed. The model was imported into Adams for kinematic simulation, and the seedling picking mechanism’s trajectory during the operation was obtained through simulation. Modal analysis of the model was performed using Ansys, and the first six-order modal vibration patterns and modal frequencies of the seedling picking mechanism were obtained under the simulated working environment. The results confirmed that no resonance occurred during the operation. Comparisons of the seedling picking needle trajectory with the idle test revealed that the theoretical, simulated, and test trajectories were approximately identical. This proved the reliability of the theoretical design of the seedling picking mechanism, the machining of the parts, and the test bench construction. The success rates of seedling picking were 97.66, 96.09, 93.75, and 90.63% at 90, 100, 110, and 120 plants/min, respectively, with rates of substrate damage of 4.43%, 6.73%, 9.57%, and 14.37%, respectively. Thus, the experimental results confirmed that the operating parameters of the cam-linked planetary gear system seedling picking mechanism satisfied the design requirements. |
| first_indexed | 2024-03-11T05:21:15Z |
| format | Article |
| id | doaj.art-c5c1ba895fb74e909269c19da828cdbd |
| institution | Directory Open Access Journal |
| issn | 2077-0472 |
| language | English |
| last_indexed | 2024-03-11T05:21:15Z |
| publishDate | 2023-03-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Agriculture |
| spelling | doaj.art-c5c1ba895fb74e909269c19da828cdbd2023-11-17T17:53:47ZengMDPI AGAgriculture2077-04722023-03-0113481010.3390/agriculture13040810Design and Mechanical Analysis of a Cam-Linked Planetary Gear System Seedling Picking MechanismXin Jin0Bo Zhang1Hongbin Suo2Cheng Lin3Jiangtao Ji4Xiaolin Xie5College of Agricultural Equipment Engineering, Henan University of Science and Technology, Luoyang 471003, ChinaCollege of Agricultural Equipment Engineering, Henan University of Science and Technology, Luoyang 471003, ChinaCollege of Agricultural Equipment Engineering, Henan University of Science and Technology, Luoyang 471003, ChinaCollege of Agricultural Equipment Engineering, Henan University of Science and Technology, Luoyang 471003, ChinaCollege of Agricultural Equipment Engineering, Henan University of Science and Technology, Luoyang 471003, ChinaCollege of Agricultural Equipment Engineering, Henan University of Science and Technology, Luoyang 471003, ChinaThis study designed a cam-linked planetary gear system automatic seedling picking mechanism to address unstable operation and issues of high damage to the substrate caused by the picking mechanism of the dryland vegetable seedling transplanter. Through an analysis of the kinematic principle of the structure and the establishment of the kinematic model, computer-aided analysis software was developed using Visual Basic 6.0. Consequently, a set of structural parameter values satisfying the target trajectory was derived employing the human–computer interaction method, and the 3D model was designed. The model was imported into Adams for kinematic simulation, and the seedling picking mechanism’s trajectory during the operation was obtained through simulation. Modal analysis of the model was performed using Ansys, and the first six-order modal vibration patterns and modal frequencies of the seedling picking mechanism were obtained under the simulated working environment. The results confirmed that no resonance occurred during the operation. Comparisons of the seedling picking needle trajectory with the idle test revealed that the theoretical, simulated, and test trajectories were approximately identical. This proved the reliability of the theoretical design of the seedling picking mechanism, the machining of the parts, and the test bench construction. The success rates of seedling picking were 97.66, 96.09, 93.75, and 90.63% at 90, 100, 110, and 120 plants/min, respectively, with rates of substrate damage of 4.43%, 6.73%, 9.57%, and 14.37%, respectively. Thus, the experimental results confirmed that the operating parameters of the cam-linked planetary gear system seedling picking mechanism satisfied the design requirements.https://www.mdpi.com/2077-0472/13/4/810seedling picking mechanismtrajectory optimizationkinematic simulationmodal analysis |
| spellingShingle | Xin Jin Bo Zhang Hongbin Suo Cheng Lin Jiangtao Ji Xiaolin Xie Design and Mechanical Analysis of a Cam-Linked Planetary Gear System Seedling Picking Mechanism Agriculture seedling picking mechanism trajectory optimization kinematic simulation modal analysis |
| title | Design and Mechanical Analysis of a Cam-Linked Planetary Gear System Seedling Picking Mechanism |
| title_full | Design and Mechanical Analysis of a Cam-Linked Planetary Gear System Seedling Picking Mechanism |
| title_fullStr | Design and Mechanical Analysis of a Cam-Linked Planetary Gear System Seedling Picking Mechanism |
| title_full_unstemmed | Design and Mechanical Analysis of a Cam-Linked Planetary Gear System Seedling Picking Mechanism |
| title_short | Design and Mechanical Analysis of a Cam-Linked Planetary Gear System Seedling Picking Mechanism |
| title_sort | design and mechanical analysis of a cam linked planetary gear system seedling picking mechanism |
| topic | seedling picking mechanism trajectory optimization kinematic simulation modal analysis |
| url | https://www.mdpi.com/2077-0472/13/4/810 |
| work_keys_str_mv | AT xinjin designandmechanicalanalysisofacamlinkedplanetarygearsystemseedlingpickingmechanism AT bozhang designandmechanicalanalysisofacamlinkedplanetarygearsystemseedlingpickingmechanism AT hongbinsuo designandmechanicalanalysisofacamlinkedplanetarygearsystemseedlingpickingmechanism AT chenglin designandmechanicalanalysisofacamlinkedplanetarygearsystemseedlingpickingmechanism AT jiangtaoji designandmechanicalanalysisofacamlinkedplanetarygearsystemseedlingpickingmechanism AT xiaolinxie designandmechanicalanalysisofacamlinkedplanetarygearsystemseedlingpickingmechanism |