Expression of hsa-MIR-204, RUNX2, PPARγ, and BCL2 in Bone Marrow Derived Mesenchymal Stem Cells from Multiple Myeloma Patients and Normal Individuals
Objective Multiple Myeloma (MM) is a heterogeneous cytogenetic disorder in which clonal plasma cells proliferate in the bone marrow (BM) and cause bone destruction. The BM microenvironment plays a crucial role in pathogenesis of this disease, and mesenchymal stem cells (MSCs) are one of the key pla...
| Main Authors: | , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Royan Institute (ACECR), Tehran
2017-05-01
|
| Series: | Cell Journal |
| Subjects: | |
| Online Access: | http://celljournal.org/journal/article/12119/download |
| _version_ | 1817986848672186368 |
|---|---|
| author | Raziyeh Mansurabadi Saeid Abroun Abass Hajifathali Amir Asri Kojabad Amir Atashi Mansoureh Haghighi |
| author_facet | Raziyeh Mansurabadi Saeid Abroun Abass Hajifathali Amir Asri Kojabad Amir Atashi Mansoureh Haghighi |
| author_sort | Raziyeh Mansurabadi |
| collection | DOAJ |
| description | Objective
Multiple Myeloma (MM) is a heterogeneous cytogenetic disorder in which clonal plasma cells proliferate in the bone marrow (BM) and cause bone destruction. The BM microenvironment plays a crucial role in pathogenesis of this disease, and mesenchymal stem cells (MSCs) are one of the key players. Herein, we propose to investigate the expressions of hsa-MIR-204, runt-related transcription factor 2 (RUNX2), peroxisome proliferator-activated receptor gamma (PPARγ), and B-cell lymphoma 2 (BCL2) as factors involved in osteogenesis, adipogenesis, and MSC survival in BM-MSCs from MM patients and normal individuals.
Materials and Methods
In this experimental study, we isolated MSCs from BM aspirates of MM patients and healthy donors. Total RNA were extracted before and after co-culture with L363 myeloma cells. Gene expressions of RUNX2, PPARγ, BCL2, and hsa-MIR-204 were assessed by quantitive real time polymerase chain reaction (qRT-PCR).
Results
Higher levels of RUNX2, PPARγ, and hsa-MIR-204 expressions existed in MM- MSCs compared to normally derived (ND)-MSCs. BCL2 expression decreased in MM- MSCs. We observed different results in the co-culture model.
Conclusion
In general, the MM-MSCs gene expression profile differed compared to ND- MSCs. Upregulation of RUNX2, PPARγ, and hsa-MIR-204 in MM-MSCs compared to ND- MSCs would result in formation of bone defects. Downregulation of BCL2 would lead to MM-MSC cell death. |
| first_indexed | 2024-04-14T00:14:31Z |
| format | Article |
| id | doaj.art-c85c929794e94ecdb6a4d7bb52860877 |
| institution | Directory Open Access Journal |
| issn | 2228-5806 2228-5814 |
| language | English |
| last_indexed | 2024-04-14T00:14:31Z |
| publishDate | 2017-05-01 |
| publisher | Royan Institute (ACECR), Tehran |
| record_format | Article |
| series | Cell Journal |
| spelling | doaj.art-c85c929794e94ecdb6a4d7bb528608772022-12-22T02:23:11ZengRoyan Institute (ACECR), TehranCell Journal2228-58062228-58142017-05-0119supp1273610.22074/cellj.2017.4480Expression of hsa-MIR-204, RUNX2, PPARγ, and BCL2 in Bone Marrow Derived Mesenchymal Stem Cells from Multiple Myeloma Patients and Normal IndividualsRaziyeh Mansurabadi0Saeid Abroun1Abass Hajifathali2Amir Asri Kojabad3Amir Atashi4Mansoureh Haghighi5Department of Hematology, Faculty of Medical Sciences, Tarbiat Modares University, Tehran, IranDepartment of Hematology, Faculty of Medical Sciences, Tarbiat Modares University, Tehran, IranBone Marrow Transplantation Center, Taleghani Hospital, Shahid Beheshti University of Medical Sciences, Tehran, IranDepartment of Hematology, Faculty of Medical Sciences, Tarbiat Modares University, Tehran, IranDepartment of Hematology, Faculty of Medical Sciences, Tarbiat Modares University, Tehran, IranDepartment of Clinical Biochemistry, Faculty of Pharmacy and Pharmaceutical Sciences, Isfahan University of Medical Sciences, IranObjective Multiple Myeloma (MM) is a heterogeneous cytogenetic disorder in which clonal plasma cells proliferate in the bone marrow (BM) and cause bone destruction. The BM microenvironment plays a crucial role in pathogenesis of this disease, and mesenchymal stem cells (MSCs) are one of the key players. Herein, we propose to investigate the expressions of hsa-MIR-204, runt-related transcription factor 2 (RUNX2), peroxisome proliferator-activated receptor gamma (PPARγ), and B-cell lymphoma 2 (BCL2) as factors involved in osteogenesis, adipogenesis, and MSC survival in BM-MSCs from MM patients and normal individuals. Materials and Methods In this experimental study, we isolated MSCs from BM aspirates of MM patients and healthy donors. Total RNA were extracted before and after co-culture with L363 myeloma cells. Gene expressions of RUNX2, PPARγ, BCL2, and hsa-MIR-204 were assessed by quantitive real time polymerase chain reaction (qRT-PCR). Results Higher levels of RUNX2, PPARγ, and hsa-MIR-204 expressions existed in MM- MSCs compared to normally derived (ND)-MSCs. BCL2 expression decreased in MM- MSCs. We observed different results in the co-culture model. Conclusion In general, the MM-MSCs gene expression profile differed compared to ND- MSCs. Upregulation of RUNX2, PPARγ, and hsa-MIR-204 in MM-MSCs compared to ND- MSCs would result in formation of bone defects. Downregulation of BCL2 would lead to MM-MSC cell death.http://celljournal.org/journal/article/12119/downloadMultiple MyelomaMesenchymal Stem Cellshsa-MIR-204RUNX2 |
| spellingShingle | Raziyeh Mansurabadi Saeid Abroun Abass Hajifathali Amir Asri Kojabad Amir Atashi Mansoureh Haghighi Expression of hsa-MIR-204, RUNX2, PPARγ, and BCL2 in Bone Marrow Derived Mesenchymal Stem Cells from Multiple Myeloma Patients and Normal Individuals Cell Journal Multiple Myeloma Mesenchymal Stem Cells hsa-MIR-204 RUNX2 |
| title | Expression of hsa-MIR-204, RUNX2, PPARγ, and BCL2 in Bone Marrow Derived Mesenchymal Stem Cells from Multiple Myeloma Patients and Normal Individuals |
| title_full | Expression of hsa-MIR-204, RUNX2, PPARγ, and BCL2 in Bone Marrow Derived Mesenchymal Stem Cells from Multiple Myeloma Patients and Normal Individuals |
| title_fullStr | Expression of hsa-MIR-204, RUNX2, PPARγ, and BCL2 in Bone Marrow Derived Mesenchymal Stem Cells from Multiple Myeloma Patients and Normal Individuals |
| title_full_unstemmed | Expression of hsa-MIR-204, RUNX2, PPARγ, and BCL2 in Bone Marrow Derived Mesenchymal Stem Cells from Multiple Myeloma Patients and Normal Individuals |
| title_short | Expression of hsa-MIR-204, RUNX2, PPARγ, and BCL2 in Bone Marrow Derived Mesenchymal Stem Cells from Multiple Myeloma Patients and Normal Individuals |
| title_sort | expression of hsa mir 204 runx2 pparγ and bcl2 in bone marrow derived mesenchymal stem cells from multiple myeloma patients and normal individuals |
| topic | Multiple Myeloma Mesenchymal Stem Cells hsa-MIR-204 RUNX2 |
| url | http://celljournal.org/journal/article/12119/download |
| work_keys_str_mv | AT raziyehmansurabadi expressionofhsamir204runx2ppargandbcl2inbonemarrowderivedmesenchymalstemcellsfrommultiplemyelomapatientsandnormalindividuals AT saeidabroun expressionofhsamir204runx2ppargandbcl2inbonemarrowderivedmesenchymalstemcellsfrommultiplemyelomapatientsandnormalindividuals AT abasshajifathali expressionofhsamir204runx2ppargandbcl2inbonemarrowderivedmesenchymalstemcellsfrommultiplemyelomapatientsandnormalindividuals AT amirasrikojabad expressionofhsamir204runx2ppargandbcl2inbonemarrowderivedmesenchymalstemcellsfrommultiplemyelomapatientsandnormalindividuals AT amiratashi expressionofhsamir204runx2ppargandbcl2inbonemarrowderivedmesenchymalstemcellsfrommultiplemyelomapatientsandnormalindividuals AT mansourehhaghighi expressionofhsamir204runx2ppargandbcl2inbonemarrowderivedmesenchymalstemcellsfrommultiplemyelomapatientsandnormalindividuals |