Advance on the Role of Mitogen-activated Protein Kinase (MAPK) Signal Pathway in Non-small Cell Lung Cancer
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | zho |
| Published: |
Chinese Anti-Cancer Association; Chinese Antituberculosis Association
2009-09-01
|
| Series: | Chinese Journal of Lung Cancer |
| Subjects: | |
| Online Access: | http://www.lungca.org/index.php?journal=01&page=article&op=viewFile&path[]=10.3779%2Fj.issn.1009-3419.2009.09.016&path[]=1110 |
| _version_ | 1818007979427889152 |
|---|---|
| author | Yuhui ZHOU Zhen ZHAN Yuping TANG Jin’ao DUAN Xu ZHANG |
| author_facet | Yuhui ZHOU Zhen ZHAN Yuping TANG Jin’ao DUAN Xu ZHANG |
| author_sort | Yuhui ZHOU |
| collection | DOAJ |
| first_indexed | 2024-04-14T05:22:50Z |
| format | Article |
| id | doaj.art-c8f0acd585b1441d865f615f2113e8f5 |
| institution | Directory Open Access Journal |
| issn | 1009-3419 1999-6187 |
| language | zho |
| last_indexed | 2024-04-14T05:22:50Z |
| publishDate | 2009-09-01 |
| publisher | Chinese Anti-Cancer Association; Chinese Antituberculosis Association |
| record_format | Article |
| series | Chinese Journal of Lung Cancer |
| spelling | doaj.art-c8f0acd585b1441d865f615f2113e8f52022-12-22T02:10:06ZzhoChinese Anti-Cancer Association; Chinese Antituberculosis AssociationChinese Journal of Lung Cancer1009-34191999-61872009-09-0112910361040Advance on the Role of Mitogen-activated Protein Kinase (MAPK) Signal Pathway in Non-small Cell Lung CancerYuhui ZHOUZhen ZHANYuping TANGJin’ao DUANXu ZHANGhttp://www.lungca.org/index.php?journal=01&page=article&op=viewFile&path[]=10.3779%2Fj.issn.1009-3419.2009.09.016&path[]=1110Lung neoplasms |
| spellingShingle | Yuhui ZHOU Zhen ZHAN Yuping TANG Jin’ao DUAN Xu ZHANG Advance on the Role of Mitogen-activated Protein Kinase (MAPK) Signal Pathway in Non-small Cell Lung Cancer Chinese Journal of Lung Cancer Lung neoplasms |
| title | Advance on the Role of Mitogen-activated Protein Kinase (MAPK) Signal Pathway in Non-small Cell Lung Cancer |
| title_full | Advance on the Role of Mitogen-activated Protein Kinase (MAPK) Signal Pathway in Non-small Cell Lung Cancer |
| title_fullStr | Advance on the Role of Mitogen-activated Protein Kinase (MAPK) Signal Pathway in Non-small Cell Lung Cancer |
| title_full_unstemmed | Advance on the Role of Mitogen-activated Protein Kinase (MAPK) Signal Pathway in Non-small Cell Lung Cancer |
| title_short | Advance on the Role of Mitogen-activated Protein Kinase (MAPK) Signal Pathway in Non-small Cell Lung Cancer |
| title_sort | advance on the role of mitogen activated protein kinase mapk signal pathway in non small cell lung cancer |
| topic | Lung neoplasms |
| url | http://www.lungca.org/index.php?journal=01&page=article&op=viewFile&path[]=10.3779%2Fj.issn.1009-3419.2009.09.016&path[]=1110 |
| work_keys_str_mv | AT yuhuizhou advanceontheroleofmitogenactivatedproteinkinasemapksignalpathwayinnonsmallcelllungcancer AT zhenzhan advanceontheroleofmitogenactivatedproteinkinasemapksignalpathwayinnonsmallcelllungcancer AT yupingtang advanceontheroleofmitogenactivatedproteinkinasemapksignalpathwayinnonsmallcelllungcancer AT jinaoduan advanceontheroleofmitogenactivatedproteinkinasemapksignalpathwayinnonsmallcelllungcancer AT xuzhang advanceontheroleofmitogenactivatedproteinkinasemapksignalpathwayinnonsmallcelllungcancer |