The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids.
The Madagascar periwinkle (Catharanthusroseus in the family Apocynaceae) is an important medicinal plant and is the source of several widely marketed chemotherapeutic drugs. It is also commonly grown for its ornamental values and, due to ease of infection and distinctiveness of symptoms, is often us...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Public Library of Science (PLoS)
2013-01-01
|
| Series: | PLoS ONE |
| Online Access: | http://europepmc.org/articles/PMC3688999?pdf=render |
| _version_ | 1828203336041496576 |
|---|---|
| author | Chuan Ku Wan-Chia Chung Ling-Ling Chen Chih-Horng Kuo |
| author_facet | Chuan Ku Wan-Chia Chung Ling-Ling Chen Chih-Horng Kuo |
| author_sort | Chuan Ku |
| collection | DOAJ |
| description | The Madagascar periwinkle (Catharanthusroseus in the family Apocynaceae) is an important medicinal plant and is the source of several widely marketed chemotherapeutic drugs. It is also commonly grown for its ornamental values and, due to ease of infection and distinctiveness of symptoms, is often used as the host for studies on phytoplasmas, an important group of uncultivated plant pathogens. To gain insights into the characteristics of apocynaceous plastid genomes (plastomes), we used a reference-assisted approach to assemble the complete plastome of C. roseus, which could be applied to other C. roseus-related studies. The C. roseus plastome is the second completely sequenced plastome in the asterid order Gentianales. We performed comparative analyses with two other representative sequences in the same order, including the complete plastome of Coffeaarabica (from the basal Gentianales family Rubiaceae) and the nearly complete plastome of Asclepiassyriaca (Apocynaceae). The results demonstrated considerable variations in gene content and plastome organization within Apocynaceae, including the presence/absence of three essential genes (i.e., accD, clpP, and ycf1) and large size changes in non-coding regions (e.g., rps2-rpoC2 and IRb-ndhF). To find plastome markers of potential utility for Catharanthus breeding and phylogenetic analyses, we identified 41 C. roseus-specific simple sequence repeats. Furthermore, five intergenic regions with high divergence between C. roseus and three other euasterids I taxa were identified as candidate markers. To resolve the euasterids I interordinal relationships, 82 plastome genes were used for phylogenetic inference. With the addition of representatives from Apocynaceae and sampling of most other asterid orders, a sister relationship between Gentianales and Solanales is supported. |
| first_indexed | 2024-04-12T12:03:56Z |
| format | Article |
| id | doaj.art-cc82fa1b45be44d3b607cedc1df15bfc |
| institution | Directory Open Access Journal |
| issn | 1932-6203 |
| language | English |
| last_indexed | 2024-04-12T12:03:56Z |
| publishDate | 2013-01-01 |
| publisher | Public Library of Science (PLoS) |
| record_format | Article |
| series | PLoS ONE |
| spelling | doaj.art-cc82fa1b45be44d3b607cedc1df15bfc2022-12-22T03:33:46ZengPublic Library of Science (PLoS)PLoS ONE1932-62032013-01-0186e6851810.1371/journal.pone.0068518The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids.Chuan KuWan-Chia ChungLing-Ling ChenChih-Horng KuoThe Madagascar periwinkle (Catharanthusroseus in the family Apocynaceae) is an important medicinal plant and is the source of several widely marketed chemotherapeutic drugs. It is also commonly grown for its ornamental values and, due to ease of infection and distinctiveness of symptoms, is often used as the host for studies on phytoplasmas, an important group of uncultivated plant pathogens. To gain insights into the characteristics of apocynaceous plastid genomes (plastomes), we used a reference-assisted approach to assemble the complete plastome of C. roseus, which could be applied to other C. roseus-related studies. The C. roseus plastome is the second completely sequenced plastome in the asterid order Gentianales. We performed comparative analyses with two other representative sequences in the same order, including the complete plastome of Coffeaarabica (from the basal Gentianales family Rubiaceae) and the nearly complete plastome of Asclepiassyriaca (Apocynaceae). The results demonstrated considerable variations in gene content and plastome organization within Apocynaceae, including the presence/absence of three essential genes (i.e., accD, clpP, and ycf1) and large size changes in non-coding regions (e.g., rps2-rpoC2 and IRb-ndhF). To find plastome markers of potential utility for Catharanthus breeding and phylogenetic analyses, we identified 41 C. roseus-specific simple sequence repeats. Furthermore, five intergenic regions with high divergence between C. roseus and three other euasterids I taxa were identified as candidate markers. To resolve the euasterids I interordinal relationships, 82 plastome genes were used for phylogenetic inference. With the addition of representatives from Apocynaceae and sampling of most other asterid orders, a sister relationship between Gentianales and Solanales is supported.http://europepmc.org/articles/PMC3688999?pdf=render |
| spellingShingle | Chuan Ku Wan-Chia Chung Ling-Ling Chen Chih-Horng Kuo The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids. PLoS ONE |
| title | The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids. |
| title_full | The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids. |
| title_fullStr | The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids. |
| title_full_unstemmed | The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids. |
| title_short | The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids. |
| title_sort | complete plastid genome sequence of madagascar periwinkle catharanthus roseus l g don plastid genome evolution molecular marker identification and phylogenetic implications in asterids |
| url | http://europepmc.org/articles/PMC3688999?pdf=render |
| work_keys_str_mv | AT chuanku thecompleteplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids AT wanchiachung thecompleteplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids AT linglingchen thecompleteplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids AT chihhorngkuo thecompleteplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids AT chuanku completeplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids AT wanchiachung completeplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids AT linglingchen completeplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids AT chihhorngkuo completeplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids |