Comparative effectiveness of traditional Chinese medicine and angiotensin converting enzyme inhibitors, angiotensin receptor blockers, and sodium glucose cotransporter inhibitors in patients with diabetic kidney disease: A systematic review and network meta-analysis
Angiotensin converting enzyme inhibitors (ACEI), angiotensin receptor blockers (ARB), and sodium glucose cotransporter inhibitors (SGLT2i) are commonly used to treat diabetic kidney disease (DKD). Currently, increasing evidence also suggests traditional Chinese medicine (TCM) as an effective strateg...
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Elsevier
2022-03-01
|
| Series: | Pharmacological Research |
| Subjects: | |
| Online Access: | http://www.sciencedirect.com/science/article/pii/S1043661822000561 |
| _version_ | 1827391204304617472 |
|---|---|
| author | Lili Zhang Runyu Miao Tongyue Yu Ruonan Wei Feng Tian Yishan Huang Xiaolin Tong Linhua Zhao |
| author_facet | Lili Zhang Runyu Miao Tongyue Yu Ruonan Wei Feng Tian Yishan Huang Xiaolin Tong Linhua Zhao |
| author_sort | Lili Zhang |
| collection | DOAJ |
| description | Angiotensin converting enzyme inhibitors (ACEI), angiotensin receptor blockers (ARB), and sodium glucose cotransporter inhibitors (SGLT2i) are commonly used to treat diabetic kidney disease (DKD). Currently, increasing evidence also suggests traditional Chinese medicine (TCM) as an effective strategy. We assessed the efficacy of ACEI, ARB, SGLT2i, and TCM on major renal outcomes. We searched the electronic literature published up to March 2021 from CNKI, VIP, WanFang, SinoMed, PubMed, Embase, Cochrane Library, Web of Science, and clinicaltrials.gov; a total of 56 studies and 5464 participants were included. We found that TCM plus ACEI, TCM plus ARB, and TCM alone are very effective treatment methods compared with ACEI, ARB, and the placebo in reducing 24-h urine protein, serum creatinine, and blood urea nitrogen. TCM plus ACEI was the most effective treatment (TCM plus ACEI vs. the placebo in 24-h urine protein [mean difference (MD) − 757.18, 95% confidence interval-1177.41 to − 353.31], serum creatinine [MD − 25.81, 95% confidence interval − 35.51 to − 16.03], and blood urea nitrogen [MD − 3.48, 95% confidence interval − 5.04 to − 1.90]). Although the incidence of end-stage renal disease while receiving an TCM plus ARB compared with a placebo was not statistically significant, the treatment ranking showed this combination therapy to have the greatest probability (72.8%) of reducing end-stage renal disease mortality, followed by SGLT2i (68%). Our analyses showed that combining TCM with conventional treatments for patients with DKD can improve renoprotective effects and superiority, and ACEI plus TCM may be the most effective option for treating DKD. |
| first_indexed | 2024-03-08T17:07:20Z |
| format | Article |
| id | doaj.art-d686f1af1d8147dcb463b9f9c3b8950c |
| institution | Directory Open Access Journal |
| issn | 1096-1186 |
| language | English |
| last_indexed | 2024-03-08T17:07:20Z |
| publishDate | 2022-03-01 |
| publisher | Elsevier |
| record_format | Article |
| series | Pharmacological Research |
| spelling | doaj.art-d686f1af1d8147dcb463b9f9c3b8950c2024-01-04T04:36:25ZengElsevierPharmacological Research1096-11862022-03-01177106111Comparative effectiveness of traditional Chinese medicine and angiotensin converting enzyme inhibitors, angiotensin receptor blockers, and sodium glucose cotransporter inhibitors in patients with diabetic kidney disease: A systematic review and network meta-analysisLili Zhang0Runyu Miao1Tongyue Yu2Ruonan Wei3Feng Tian4Yishan Huang5Xiaolin Tong6Linhua Zhao7Department of Endocrinology, Guang’anmen Hospital, China Academy of Chinese Medical Sciences, Beijing 100053, ChinaGraduate College, Beijing University of Chinese Medicine, Beijing 100029, ChinaDepartment of Endocrinology, Guang’anmen Hospital, China Academy of Chinese Medical Sciences, Beijing 100053, ChinaGansu University of Chinese Medicine, Lanzhou 730000, ChinaBrilliant International, Building No. 5, Zhongguancun Science Park Shangdi North District, Haidian District, Beijing 100085, ChinaDepartment of Endocrinology, Guang’anmen Hospital, China Academy of Chinese Medical Sciences, Beijing 100053, China; Corresponding authors.Department of Endocrinology, Guang’anmen Hospital, China Academy of Chinese Medical Sciences, Beijing 100053, China; Corresponding authors.Department of Endocrinology, Guang’anmen Hospital, China Academy of Chinese Medical Sciences, Beijing 100053, China; Corresponding authors.Angiotensin converting enzyme inhibitors (ACEI), angiotensin receptor blockers (ARB), and sodium glucose cotransporter inhibitors (SGLT2i) are commonly used to treat diabetic kidney disease (DKD). Currently, increasing evidence also suggests traditional Chinese medicine (TCM) as an effective strategy. We assessed the efficacy of ACEI, ARB, SGLT2i, and TCM on major renal outcomes. We searched the electronic literature published up to March 2021 from CNKI, VIP, WanFang, SinoMed, PubMed, Embase, Cochrane Library, Web of Science, and clinicaltrials.gov; a total of 56 studies and 5464 participants were included. We found that TCM plus ACEI, TCM plus ARB, and TCM alone are very effective treatment methods compared with ACEI, ARB, and the placebo in reducing 24-h urine protein, serum creatinine, and blood urea nitrogen. TCM plus ACEI was the most effective treatment (TCM plus ACEI vs. the placebo in 24-h urine protein [mean difference (MD) − 757.18, 95% confidence interval-1177.41 to − 353.31], serum creatinine [MD − 25.81, 95% confidence interval − 35.51 to − 16.03], and blood urea nitrogen [MD − 3.48, 95% confidence interval − 5.04 to − 1.90]). Although the incidence of end-stage renal disease while receiving an TCM plus ARB compared with a placebo was not statistically significant, the treatment ranking showed this combination therapy to have the greatest probability (72.8%) of reducing end-stage renal disease mortality, followed by SGLT2i (68%). Our analyses showed that combining TCM with conventional treatments for patients with DKD can improve renoprotective effects and superiority, and ACEI plus TCM may be the most effective option for treating DKD.http://www.sciencedirect.com/science/article/pii/S1043661822000561Diabetic kidney diseaseNetwork meta-analysisTraditional Chinese medicine |
| spellingShingle | Lili Zhang Runyu Miao Tongyue Yu Ruonan Wei Feng Tian Yishan Huang Xiaolin Tong Linhua Zhao Comparative effectiveness of traditional Chinese medicine and angiotensin converting enzyme inhibitors, angiotensin receptor blockers, and sodium glucose cotransporter inhibitors in patients with diabetic kidney disease: A systematic review and network meta-analysis Pharmacological Research Diabetic kidney disease Network meta-analysis Traditional Chinese medicine |
| title | Comparative effectiveness of traditional Chinese medicine and angiotensin converting enzyme inhibitors, angiotensin receptor blockers, and sodium glucose cotransporter inhibitors in patients with diabetic kidney disease: A systematic review and network meta-analysis |
| title_full | Comparative effectiveness of traditional Chinese medicine and angiotensin converting enzyme inhibitors, angiotensin receptor blockers, and sodium glucose cotransporter inhibitors in patients with diabetic kidney disease: A systematic review and network meta-analysis |
| title_fullStr | Comparative effectiveness of traditional Chinese medicine and angiotensin converting enzyme inhibitors, angiotensin receptor blockers, and sodium glucose cotransporter inhibitors in patients with diabetic kidney disease: A systematic review and network meta-analysis |
| title_full_unstemmed | Comparative effectiveness of traditional Chinese medicine and angiotensin converting enzyme inhibitors, angiotensin receptor blockers, and sodium glucose cotransporter inhibitors in patients with diabetic kidney disease: A systematic review and network meta-analysis |
| title_short | Comparative effectiveness of traditional Chinese medicine and angiotensin converting enzyme inhibitors, angiotensin receptor blockers, and sodium glucose cotransporter inhibitors in patients with diabetic kidney disease: A systematic review and network meta-analysis |
| title_sort | comparative effectiveness of traditional chinese medicine and angiotensin converting enzyme inhibitors angiotensin receptor blockers and sodium glucose cotransporter inhibitors in patients with diabetic kidney disease a systematic review and network meta analysis |
| topic | Diabetic kidney disease Network meta-analysis Traditional Chinese medicine |
| url | http://www.sciencedirect.com/science/article/pii/S1043661822000561 |
| work_keys_str_mv | AT lilizhang comparativeeffectivenessoftraditionalchinesemedicineandangiotensinconvertingenzymeinhibitorsangiotensinreceptorblockersandsodiumglucosecotransporterinhibitorsinpatientswithdiabetickidneydiseaseasystematicreviewandnetworkmetaanalysis AT runyumiao comparativeeffectivenessoftraditionalchinesemedicineandangiotensinconvertingenzymeinhibitorsangiotensinreceptorblockersandsodiumglucosecotransporterinhibitorsinpatientswithdiabetickidneydiseaseasystematicreviewandnetworkmetaanalysis AT tongyueyu comparativeeffectivenessoftraditionalchinesemedicineandangiotensinconvertingenzymeinhibitorsangiotensinreceptorblockersandsodiumglucosecotransporterinhibitorsinpatientswithdiabetickidneydiseaseasystematicreviewandnetworkmetaanalysis AT ruonanwei comparativeeffectivenessoftraditionalchinesemedicineandangiotensinconvertingenzymeinhibitorsangiotensinreceptorblockersandsodiumglucosecotransporterinhibitorsinpatientswithdiabetickidneydiseaseasystematicreviewandnetworkmetaanalysis AT fengtian comparativeeffectivenessoftraditionalchinesemedicineandangiotensinconvertingenzymeinhibitorsangiotensinreceptorblockersandsodiumglucosecotransporterinhibitorsinpatientswithdiabetickidneydiseaseasystematicreviewandnetworkmetaanalysis AT yishanhuang comparativeeffectivenessoftraditionalchinesemedicineandangiotensinconvertingenzymeinhibitorsangiotensinreceptorblockersandsodiumglucosecotransporterinhibitorsinpatientswithdiabetickidneydiseaseasystematicreviewandnetworkmetaanalysis AT xiaolintong comparativeeffectivenessoftraditionalchinesemedicineandangiotensinconvertingenzymeinhibitorsangiotensinreceptorblockersandsodiumglucosecotransporterinhibitorsinpatientswithdiabetickidneydiseaseasystematicreviewandnetworkmetaanalysis AT linhuazhao comparativeeffectivenessoftraditionalchinesemedicineandangiotensinconvertingenzymeinhibitorsangiotensinreceptorblockersandsodiumglucosecotransporterinhibitorsinpatientswithdiabetickidneydiseaseasystematicreviewandnetworkmetaanalysis |