Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems
AbstractThe condition for maximum power transfer of 2-coils wireless power transfer (WPT) system is derived from circuit analysis and discussed together with the respective WPT system efficiency (η). In the sequence, it is shown that a 4-coils WPT system (which can be divided in source, two communic...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Sociedade Brasileira de Microondas e Optoeletrônica; Sociedade Brasileira de Eletromagnetismo
|
| Series: | Journal of Microwaves, Optoelectronics and Electromagnetic Applications |
| Subjects: | |
| Online Access: | http://www.scielo.br/scielo.php?script=sci_arttext&pid=S2179-10742015000100097&lng=en&tlng=en |
| _version_ | 1818188793310609408 |
|---|---|
| author | Paulo J. Abatti Sérgio F. Pichorim Caio M. de Miranda |
| author_facet | Paulo J. Abatti Sérgio F. Pichorim Caio M. de Miranda |
| author_sort | Paulo J. Abatti |
| collection | DOAJ |
| description | AbstractThe condition for maximum power transfer of 2-coils wireless power transfer (WPT) system is derived from circuit analysis and discussed together with the respective WPT system efficiency (η). In the sequence, it is shown that a 4-coils WPT system (which can be divided in source, two communication and load circuits) without power losses at the two communication circuits (ideal 4-coils WPT system) presents, from maximum power transfer and efficiency point of view, a performance similar to those of a 2-coils WPT system. The exception is the influence of coupling coefficient (k): in 2-coils system η increases as k approaches one, while in ideal 4-coils WPT system η increases as k between the two communication coils approaches zero. In addition, realistic 4-coils WPT systems (with power losses at the two communication circuits) are also analyzed showing, for instance, that η presents a maximum as a function of k of the communication coils. In order to validate the presented theory, 4 coils were built, and a setup to perform 2-coils and 4-coils WPT systems has been carried out. Practical results show good agreement with the developed theory. |
| first_indexed | 2024-12-11T23:32:34Z |
| format | Article |
| id | doaj.art-d6b2096169144fb49b03c56b5ac7e317 |
| institution | Directory Open Access Journal |
| issn | 2179-1074 |
| language | English |
| last_indexed | 2024-12-11T23:32:34Z |
| publisher | Sociedade Brasileira de Microondas e Optoeletrônica; Sociedade Brasileira de Eletromagnetismo |
| record_format | Article |
| series | Journal of Microwaves, Optoelectronics and Electromagnetic Applications |
| spelling | doaj.art-d6b2096169144fb49b03c56b5ac7e3172022-12-22T00:45:59ZengSociedade Brasileira de Microondas e Optoeletrônica; Sociedade Brasileira de EletromagnetismoJournal of Microwaves, Optoelectronics and Electromagnetic Applications2179-10741419710910.1590/2179-10742015v14i1433S2179-10742015000100097Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer SystemsPaulo J. AbattiSérgio F. PichorimCaio M. de MirandaAbstractThe condition for maximum power transfer of 2-coils wireless power transfer (WPT) system is derived from circuit analysis and discussed together with the respective WPT system efficiency (η). In the sequence, it is shown that a 4-coils WPT system (which can be divided in source, two communication and load circuits) without power losses at the two communication circuits (ideal 4-coils WPT system) presents, from maximum power transfer and efficiency point of view, a performance similar to those of a 2-coils WPT system. The exception is the influence of coupling coefficient (k): in 2-coils system η increases as k approaches one, while in ideal 4-coils WPT system η increases as k between the two communication coils approaches zero. In addition, realistic 4-coils WPT systems (with power losses at the two communication circuits) are also analyzed showing, for instance, that η presents a maximum as a function of k of the communication coils. In order to validate the presented theory, 4 coils were built, and a setup to perform 2-coils and 4-coils WPT systems has been carried out. Practical results show good agreement with the developed theory.http://www.scielo.br/scielo.php?script=sci_arttext&pid=S2179-10742015000100097&lng=en&tlng=enMaximum power transferpower transfer efficiencyrelative power transferwireless power transfer |
| spellingShingle | Paulo J. Abatti Sérgio F. Pichorim Caio M. de Miranda Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems Journal of Microwaves, Optoelectronics and Electromagnetic Applications Maximum power transfer power transfer efficiency relative power transfer wireless power transfer |
| title | Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems |
| title_full | Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems |
| title_fullStr | Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems |
| title_full_unstemmed | Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems |
| title_short | Maximum Power Transfer versus Efficiency in Mid-Range Wireless Power Transfer Systems |
| title_sort | maximum power transfer versus efficiency in mid range wireless power transfer systems |
| topic | Maximum power transfer power transfer efficiency relative power transfer wireless power transfer |
| url | http://www.scielo.br/scielo.php?script=sci_arttext&pid=S2179-10742015000100097&lng=en&tlng=en |
| work_keys_str_mv | AT paulojabatti maximumpowertransferversusefficiencyinmidrangewirelesspowertransfersystems AT sergiofpichorim maximumpowertransferversusefficiencyinmidrangewirelesspowertransfersystems AT caiomdemiranda maximumpowertransferversusefficiencyinmidrangewirelesspowertransfersystems |