Identification, Characterization and Synthesis of Walterospermin, a Sperm Motility Activator from the Egyptian Black Snake <i>Walterinnesia aegyptia</i> Venom
Animal venoms are small natural mixtures highly enriched in bioactive components. They are known to target at least two important pharmacological classes of cell surface receptors: ion channels and G protein coupled receptors. Since sperm cells express a wide variety of ion channels and membrane rec...
Main Authors: | , , , , , , , , , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
MDPI AG
2020-10-01
|
Series: | International Journal of Molecular Sciences |
Subjects: | |
Online Access: | https://www.mdpi.com/1422-0067/21/20/7786 |
_version_ | 1797550350300872704 |
---|---|
author | Tarek Mohamed Abd El-Aziz Lucie Jaquillard Sandrine Bourgoin-Voillard Guillaume Martinez Mathilde Triquigneaux Claude Zoukimian Stéphanie Combemale Jean-Pascal Hograindleur Sawsan Al Khoury Jessica Escoffier Sylvie Michelland Philippe Bulet Rémy Beroud Michel Seve Christophe Arnoult Michel De Waard |
author_facet | Tarek Mohamed Abd El-Aziz Lucie Jaquillard Sandrine Bourgoin-Voillard Guillaume Martinez Mathilde Triquigneaux Claude Zoukimian Stéphanie Combemale Jean-Pascal Hograindleur Sawsan Al Khoury Jessica Escoffier Sylvie Michelland Philippe Bulet Rémy Beroud Michel Seve Christophe Arnoult Michel De Waard |
author_sort | Tarek Mohamed Abd El-Aziz |
collection | DOAJ |
description | Animal venoms are small natural mixtures highly enriched in bioactive components. They are known to target at least two important pharmacological classes of cell surface receptors: ion channels and G protein coupled receptors. Since sperm cells express a wide variety of ion channels and membrane receptors, required for the control of cell motility and acrosome reaction, two functions that are defective in infertility issues, animal venoms should contain interesting compounds capable of modulating these two essential physiological functions. Herein, we screened for bioactive compounds from the venom of the Egyptian black snake <i>Walterinnesia aegyptia</i> (Wa) that possess the property to activate sperm motility in vitro from male mice OF1. Using RP-HPLC and cation exchange chromatography, we identified a new toxin of 6389.89 Da (termed walterospermin) that activates sperm motility. Walterospermin was <i>de novo</i> sequenced using a combination of matrix assisted laser desorption ionization time of flight mass spectrometry (MALDI-TOF/TOF MS/MS) and liquid chromatography electrospray ionization quadrupole time-of-flight mass spectrometry (LC-ESI-QTOF MS/MS) following reduction, alkylation, and enzymatic proteolytic digestion with trypsin, chymotrypsin or V8 protease. The peptide is 57 amino acid residues long and contains three disulfide bridges and was found to be identical to the previously cloned Wa Kunitz-type protease inhibitor II (Wa Kln-II) sequence. Moreover, it has strong homology with several other hitherto cloned Elapidae and Viperidae snake toxins suggesting that it belongs to a family of compounds able to regulate sperm function. The synthetic peptide shows promising activation of sperm motility from a variety of species, including humans. Its fluorescently-labelled analog predominantly marks the flagellum, a localization in agreement with a receptor that controls motility function. |
first_indexed | 2024-03-10T15:27:01Z |
format | Article |
id | doaj.art-d8e0f60767ef4ab48715eb0caa9c0cf3 |
institution | Directory Open Access Journal |
issn | 1661-6596 1422-0067 |
language | English |
last_indexed | 2024-03-10T15:27:01Z |
publishDate | 2020-10-01 |
publisher | MDPI AG |
record_format | Article |
series | International Journal of Molecular Sciences |
spelling | doaj.art-d8e0f60767ef4ab48715eb0caa9c0cf32023-11-20T17:57:35ZengMDPI AGInternational Journal of Molecular Sciences1661-65961422-00672020-10-012120778610.3390/ijms21207786Identification, Characterization and Synthesis of Walterospermin, a Sperm Motility Activator from the Egyptian Black Snake <i>Walterinnesia aegyptia</i> VenomTarek Mohamed Abd El-Aziz0Lucie Jaquillard1Sandrine Bourgoin-Voillard2Guillaume Martinez3Mathilde Triquigneaux4Claude Zoukimian5Stéphanie Combemale6Jean-Pascal Hograindleur7Sawsan Al Khoury8Jessica Escoffier9Sylvie Michelland10Philippe Bulet11Rémy Beroud12Michel Seve13Christophe Arnoult14Michel De Waard15Department of Cellular and Integrative Physiology, University of Texas Health Science Center at San Antonio, San Antonio, TX 78229-3900, USASmartox Biotechnology, 6 rue des Platanes, 38120 Saint-Egrève, FrancePROMETHEE Proteomic Platform, University Grenoble Alpes, LBFA et BEeSy, 38041 Grenoble, FranceInstitut Pour l’Avancée des Biosciences (IAB), INSERM U1209, CNRS UMR 5309, 38700 La Tronche, FranceSmartox Biotechnology, 6 rue des Platanes, 38120 Saint-Egrève, FranceSmartox Biotechnology, 6 rue des Platanes, 38120 Saint-Egrève, FranceSmartox Biotechnology, 6 rue des Platanes, 38120 Saint-Egrève, FranceInstitut Pour l’Avancée des Biosciences (IAB), INSERM U1209, CNRS UMR 5309, 38700 La Tronche, FranceL’institut du thorax, INSERM, CNRS, UNIV NANTES, F-44007 Nantes, FranceInstitut Pour l’Avancée des Biosciences (IAB), INSERM U1209, CNRS UMR 5309, 38700 La Tronche, FrancePROMETHEE Proteomic Platform, University Grenoble Alpes, LBFA et BEeSy, 38041 Grenoble, FranceInstitut Pour l’Avancée des Biosciences (IAB), INSERM U1209, CNRS UMR 5309, 38700 La Tronche, FranceSmartox Biotechnology, 6 rue des Platanes, 38120 Saint-Egrève, FrancePROMETHEE Proteomic Platform, University Grenoble Alpes, LBFA et BEeSy, 38041 Grenoble, FranceInstitut Pour l’Avancée des Biosciences (IAB), INSERM U1209, CNRS UMR 5309, 38700 La Tronche, FranceSmartox Biotechnology, 6 rue des Platanes, 38120 Saint-Egrève, FranceAnimal venoms are small natural mixtures highly enriched in bioactive components. They are known to target at least two important pharmacological classes of cell surface receptors: ion channels and G protein coupled receptors. Since sperm cells express a wide variety of ion channels and membrane receptors, required for the control of cell motility and acrosome reaction, two functions that are defective in infertility issues, animal venoms should contain interesting compounds capable of modulating these two essential physiological functions. Herein, we screened for bioactive compounds from the venom of the Egyptian black snake <i>Walterinnesia aegyptia</i> (Wa) that possess the property to activate sperm motility in vitro from male mice OF1. Using RP-HPLC and cation exchange chromatography, we identified a new toxin of 6389.89 Da (termed walterospermin) that activates sperm motility. Walterospermin was <i>de novo</i> sequenced using a combination of matrix assisted laser desorption ionization time of flight mass spectrometry (MALDI-TOF/TOF MS/MS) and liquid chromatography electrospray ionization quadrupole time-of-flight mass spectrometry (LC-ESI-QTOF MS/MS) following reduction, alkylation, and enzymatic proteolytic digestion with trypsin, chymotrypsin or V8 protease. The peptide is 57 amino acid residues long and contains three disulfide bridges and was found to be identical to the previously cloned Wa Kunitz-type protease inhibitor II (Wa Kln-II) sequence. Moreover, it has strong homology with several other hitherto cloned Elapidae and Viperidae snake toxins suggesting that it belongs to a family of compounds able to regulate sperm function. The synthetic peptide shows promising activation of sperm motility from a variety of species, including humans. Its fluorescently-labelled analog predominantly marks the flagellum, a localization in agreement with a receptor that controls motility function.https://www.mdpi.com/1422-0067/21/20/7786Snake venom<i>Walterinnesia aegyptia</i>bioactive componentssperm motilityproteomicsmass spectrometry |
spellingShingle | Tarek Mohamed Abd El-Aziz Lucie Jaquillard Sandrine Bourgoin-Voillard Guillaume Martinez Mathilde Triquigneaux Claude Zoukimian Stéphanie Combemale Jean-Pascal Hograindleur Sawsan Al Khoury Jessica Escoffier Sylvie Michelland Philippe Bulet Rémy Beroud Michel Seve Christophe Arnoult Michel De Waard Identification, Characterization and Synthesis of Walterospermin, a Sperm Motility Activator from the Egyptian Black Snake <i>Walterinnesia aegyptia</i> Venom International Journal of Molecular Sciences Snake venom <i>Walterinnesia aegyptia</i> bioactive components sperm motility proteomics mass spectrometry |
title | Identification, Characterization and Synthesis of Walterospermin, a Sperm Motility Activator from the Egyptian Black Snake <i>Walterinnesia aegyptia</i> Venom |
title_full | Identification, Characterization and Synthesis of Walterospermin, a Sperm Motility Activator from the Egyptian Black Snake <i>Walterinnesia aegyptia</i> Venom |
title_fullStr | Identification, Characterization and Synthesis of Walterospermin, a Sperm Motility Activator from the Egyptian Black Snake <i>Walterinnesia aegyptia</i> Venom |
title_full_unstemmed | Identification, Characterization and Synthesis of Walterospermin, a Sperm Motility Activator from the Egyptian Black Snake <i>Walterinnesia aegyptia</i> Venom |
title_short | Identification, Characterization and Synthesis of Walterospermin, a Sperm Motility Activator from the Egyptian Black Snake <i>Walterinnesia aegyptia</i> Venom |
title_sort | identification characterization and synthesis of walterospermin a sperm motility activator from the egyptian black snake i walterinnesia aegyptia i venom |
topic | Snake venom <i>Walterinnesia aegyptia</i> bioactive components sperm motility proteomics mass spectrometry |
url | https://www.mdpi.com/1422-0067/21/20/7786 |
work_keys_str_mv | AT tarekmohamedabdelaziz identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT luciejaquillard identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT sandrinebourgoinvoillard identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT guillaumemartinez identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT mathildetriquigneaux identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT claudezoukimian identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT stephaniecombemale identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT jeanpascalhograindleur identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT sawsanalkhoury identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT jessicaescoffier identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT sylviemichelland identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT philippebulet identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT remyberoud identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT michelseve identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT christophearnoult identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom AT micheldewaard identificationcharacterizationandsynthesisofwalterosperminaspermmotilityactivatorfromtheegyptianblacksnakeiwalterinnesiaaegyptiaivenom |