Safety and Efficacy of COVID-19 Vaccine in Africa: Systematic Review
Selamawit Mengstu, Alemseged Beyene Berha Department of Pharmacology and Clinical Pharmacy, School of Pharmacy, College of Health Sciences, Addis Ababa University, Addis Ababa, EthiopiaCorrespondence: Alemseged Beyene Berha, Email alembeyene98@gmail.comBackground: Coronavirus disease 2019 (COVID-19)...
| Main Authors: | , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Dove Medical Press
2023-05-01
|
| Series: | Infection and Drug Resistance |
| Subjects: | |
| Online Access: | https://www.dovepress.com/safety-and-efficacy-of-covid-19-vaccine-in-africa-systematic-review-peer-reviewed-fulltext-article-IDR |
| _version_ | 1797823870082744320 |
|---|---|
| author | Mengstu S Beyene Berha A |
| author_facet | Mengstu S Beyene Berha A |
| author_sort | Mengstu S |
| collection | DOAJ |
| description | Selamawit Mengstu, Alemseged Beyene Berha Department of Pharmacology and Clinical Pharmacy, School of Pharmacy, College of Health Sciences, Addis Ababa University, Addis Ababa, EthiopiaCorrespondence: Alemseged Beyene Berha, Email alembeyene98@gmail.comBackground: Coronavirus disease 2019 (COVID-19) pandemic scared the whole world at the end of 2019, which is a communicable respiratory disease caused by severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2). In South Africa and other African countries, the COVID-19 vaccines were subsequently approved for emergency use by the respective national regulatory authorities. There is a paucity of aggregated data that revealed the safety and efficacy of COVID-19 vaccines in Africa.Objective: The aim of this systematic review was to synthesize the literature on the safety and efficacy of the COVID-19 vaccine which was given in Africa.Methods: A systematic search was conducted on Science Direct, PubMed, EMBASE, Google Scholar, CINAHL, Cochrane Library, and direct Google searches. Only studies written in English and published articles from 2019 to October 30, 2022, which comprise nine randomized clinical trials (RCT), and four different studies including a single-arm implementation trials, prospective study, retrospective cohort study, and test-negative designs were included.Results: A total of 13 studies were included which contain 810,466 participants from Africa. Of these, 62.18% of the participants were female. The efficacy of COVID-19 vaccine in Africa ranges from 41.7% to 100%. Moreover, vaccine efficacy against COVID-19 variants ranges from − 5.7% to 100%. In general, systemic and local adverse events following vaccination in most trials were reported with a similar pattern between the placebo and vaccine groups. Out of the total reported adverse events, most of them were mild to moderate, whereas a few were serious.Conclusion: Almost all current COVID‐19 vaccines appear to be safe for African study participants. Regarding efficacy, the protein subunit vaccine and mRNA vaccine exhibited high efficacy (100%) in this group of participants. However, Ad26. COV2.S and ChAdOx1 nCoV-19 COVID-19 vaccines are not effective against the delta variant and B.1.351 variant, respectively.Keywords: safety, immunogenicity, efficacy, COVID-19 vaccine, Africa |
| first_indexed | 2024-03-13T10:30:25Z |
| format | Article |
| id | doaj.art-dba4ab5ec11342cfac5fc4a65483add0 |
| institution | Directory Open Access Journal |
| issn | 1178-6973 |
| language | English |
| last_indexed | 2024-03-13T10:30:25Z |
| publishDate | 2023-05-01 |
| publisher | Dove Medical Press |
| record_format | Article |
| series | Infection and Drug Resistance |
| spelling | doaj.art-dba4ab5ec11342cfac5fc4a65483add02023-05-18T18:42:34ZengDove Medical PressInfection and Drug Resistance1178-69732023-05-01Volume 163085310083834Safety and Efficacy of COVID-19 Vaccine in Africa: Systematic ReviewMengstu SBeyene Berha ASelamawit Mengstu, Alemseged Beyene Berha Department of Pharmacology and Clinical Pharmacy, School of Pharmacy, College of Health Sciences, Addis Ababa University, Addis Ababa, EthiopiaCorrespondence: Alemseged Beyene Berha, Email alembeyene98@gmail.comBackground: Coronavirus disease 2019 (COVID-19) pandemic scared the whole world at the end of 2019, which is a communicable respiratory disease caused by severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2). In South Africa and other African countries, the COVID-19 vaccines were subsequently approved for emergency use by the respective national regulatory authorities. There is a paucity of aggregated data that revealed the safety and efficacy of COVID-19 vaccines in Africa.Objective: The aim of this systematic review was to synthesize the literature on the safety and efficacy of the COVID-19 vaccine which was given in Africa.Methods: A systematic search was conducted on Science Direct, PubMed, EMBASE, Google Scholar, CINAHL, Cochrane Library, and direct Google searches. Only studies written in English and published articles from 2019 to October 30, 2022, which comprise nine randomized clinical trials (RCT), and four different studies including a single-arm implementation trials, prospective study, retrospective cohort study, and test-negative designs were included.Results: A total of 13 studies were included which contain 810,466 participants from Africa. Of these, 62.18% of the participants were female. The efficacy of COVID-19 vaccine in Africa ranges from 41.7% to 100%. Moreover, vaccine efficacy against COVID-19 variants ranges from − 5.7% to 100%. In general, systemic and local adverse events following vaccination in most trials were reported with a similar pattern between the placebo and vaccine groups. Out of the total reported adverse events, most of them were mild to moderate, whereas a few were serious.Conclusion: Almost all current COVID‐19 vaccines appear to be safe for African study participants. Regarding efficacy, the protein subunit vaccine and mRNA vaccine exhibited high efficacy (100%) in this group of participants. However, Ad26. COV2.S and ChAdOx1 nCoV-19 COVID-19 vaccines are not effective against the delta variant and B.1.351 variant, respectively.Keywords: safety, immunogenicity, efficacy, COVID-19 vaccine, Africahttps://www.dovepress.com/safety-and-efficacy-of-covid-19-vaccine-in-africa-systematic-review-peer-reviewed-fulltext-article-IDRsafetyimmunogenicityefficacycovid-19 vaccineafrica |
| spellingShingle | Mengstu S Beyene Berha A Safety and Efficacy of COVID-19 Vaccine in Africa: Systematic Review Infection and Drug Resistance safety immunogenicity efficacy covid-19 vaccine africa |
| title | Safety and Efficacy of COVID-19 Vaccine in Africa: Systematic Review |
| title_full | Safety and Efficacy of COVID-19 Vaccine in Africa: Systematic Review |
| title_fullStr | Safety and Efficacy of COVID-19 Vaccine in Africa: Systematic Review |
| title_full_unstemmed | Safety and Efficacy of COVID-19 Vaccine in Africa: Systematic Review |
| title_short | Safety and Efficacy of COVID-19 Vaccine in Africa: Systematic Review |
| title_sort | safety and efficacy of covid 19 vaccine in africa systematic review |
| topic | safety immunogenicity efficacy covid-19 vaccine africa |
| url | https://www.dovepress.com/safety-and-efficacy-of-covid-19-vaccine-in-africa-systematic-review-peer-reviewed-fulltext-article-IDR |
| work_keys_str_mv | AT mengstus safetyandefficacyofcovid19vaccineinafricasystematicreview AT beyeneberhaa safetyandefficacyofcovid19vaccineinafricasystematicreview |