Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system.
Vitamin D deficiency (VDD) is prevalent among HIV-infected individuals. Vitamin D has been associated with renal and cardiovascular diseases because of its effects on oxidative stress, lipid metabolism and renin-angiotensin-aldosterone system (RAAS). Tenofovir disoproxil fumarate (TDF), a widely use...
Main Authors: | , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Public Library of Science (PLoS)
2014-01-01
|
Series: | PLoS ONE |
Online Access: | http://europepmc.org/articles/PMC4105615?pdf=render |
_version_ | 1828752046514241536 |
---|---|
author | Daniele Canale Ana Carolina de Bragança Janaína Garcia Gonçalves Maria Heloisa Massola Shimizu Talita Rojas Sanches Lúcia Andrade Rildo Aparecido Volpini Antonio Carlos Seguro |
author_facet | Daniele Canale Ana Carolina de Bragança Janaína Garcia Gonçalves Maria Heloisa Massola Shimizu Talita Rojas Sanches Lúcia Andrade Rildo Aparecido Volpini Antonio Carlos Seguro |
author_sort | Daniele Canale |
collection | DOAJ |
description | Vitamin D deficiency (VDD) is prevalent among HIV-infected individuals. Vitamin D has been associated with renal and cardiovascular diseases because of its effects on oxidative stress, lipid metabolism and renin-angiotensin-aldosterone system (RAAS). Tenofovir disoproxil fumarate (TDF), a widely used component of antiretroviral regimens for HIV treatment, can induce renal injury. The aim of this study was to investigate the effects of VDD on TDF-induced nephrotoxicity. Wistar rats were divided into four groups: control, receiving a standard diet for 60 days; VDD, receiving a vitamin D-free diet for 60 days; TDF, receiving a standard diet for 60 days with the addition of TDF (50 mg/kg food) for the last 30 days; and VDD+TDF receiving a vitamin D-free diet for 60 days with the addition of TDF for the last 30 days. TDF led to impaired renal function, hyperphosphaturia, hypophosphatemia, hypertension and increased renal vascular resistance due to downregulation of the sodium-phosphorus cotransporter and upregulation of angiotensin II and AT1 receptor. TDF also increased oxidative stress, as evidenced by higher TBARS and lower GSH levels, and induced dyslipidemia. Association of TDF and VDD aggravated renovascular effects and TDF-induced nephrotoxicity due to changes in the redox state and involvement of RAAS. |
first_indexed | 2024-12-10T21:03:27Z |
format | Article |
id | doaj.art-ddc1acffc22d41698b714879fdff228a |
institution | Directory Open Access Journal |
issn | 1932-6203 |
language | English |
last_indexed | 2024-12-10T21:03:27Z |
publishDate | 2014-01-01 |
publisher | Public Library of Science (PLoS) |
record_format | Article |
series | PLoS ONE |
spelling | doaj.art-ddc1acffc22d41698b714879fdff228a2022-12-22T01:33:44ZengPublic Library of Science (PLoS)PLoS ONE1932-62032014-01-0197e10305510.1371/journal.pone.0103055Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system.Daniele CanaleAna Carolina de BragançaJanaína Garcia GonçalvesMaria Heloisa Massola ShimizuTalita Rojas SanchesLúcia AndradeRildo Aparecido VolpiniAntonio Carlos SeguroVitamin D deficiency (VDD) is prevalent among HIV-infected individuals. Vitamin D has been associated with renal and cardiovascular diseases because of its effects on oxidative stress, lipid metabolism and renin-angiotensin-aldosterone system (RAAS). Tenofovir disoproxil fumarate (TDF), a widely used component of antiretroviral regimens for HIV treatment, can induce renal injury. The aim of this study was to investigate the effects of VDD on TDF-induced nephrotoxicity. Wistar rats were divided into four groups: control, receiving a standard diet for 60 days; VDD, receiving a vitamin D-free diet for 60 days; TDF, receiving a standard diet for 60 days with the addition of TDF (50 mg/kg food) for the last 30 days; and VDD+TDF receiving a vitamin D-free diet for 60 days with the addition of TDF for the last 30 days. TDF led to impaired renal function, hyperphosphaturia, hypophosphatemia, hypertension and increased renal vascular resistance due to downregulation of the sodium-phosphorus cotransporter and upregulation of angiotensin II and AT1 receptor. TDF also increased oxidative stress, as evidenced by higher TBARS and lower GSH levels, and induced dyslipidemia. Association of TDF and VDD aggravated renovascular effects and TDF-induced nephrotoxicity due to changes in the redox state and involvement of RAAS.http://europepmc.org/articles/PMC4105615?pdf=render |
spellingShingle | Daniele Canale Ana Carolina de Bragança Janaína Garcia Gonçalves Maria Heloisa Massola Shimizu Talita Rojas Sanches Lúcia Andrade Rildo Aparecido Volpini Antonio Carlos Seguro Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system. PLoS ONE |
title | Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system. |
title_full | Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system. |
title_fullStr | Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system. |
title_full_unstemmed | Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system. |
title_short | Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system. |
title_sort | vitamin d deficiency aggravates nephrotoxicity hypertension and dyslipidemia caused by tenofovir role of oxidative stress and renin angiotensin system |
url | http://europepmc.org/articles/PMC4105615?pdf=render |
work_keys_str_mv | AT danielecanale vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT anacarolinadebraganca vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT janainagarciagoncalves vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT mariaheloisamassolashimizu vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT talitarojassanches vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT luciaandrade vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT rildoaparecidovolpini vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT antoniocarlosseguro vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem |