Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system.

Vitamin D deficiency (VDD) is prevalent among HIV-infected individuals. Vitamin D has been associated with renal and cardiovascular diseases because of its effects on oxidative stress, lipid metabolism and renin-angiotensin-aldosterone system (RAAS). Tenofovir disoproxil fumarate (TDF), a widely use...

Full description

Bibliographic Details
Main Authors: Daniele Canale, Ana Carolina de Bragança, Janaína Garcia Gonçalves, Maria Heloisa Massola Shimizu, Talita Rojas Sanches, Lúcia Andrade, Rildo Aparecido Volpini, Antonio Carlos Seguro
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2014-01-01
Series:PLoS ONE
Online Access:http://europepmc.org/articles/PMC4105615?pdf=render
_version_ 1828752046514241536
author Daniele Canale
Ana Carolina de Bragança
Janaína Garcia Gonçalves
Maria Heloisa Massola Shimizu
Talita Rojas Sanches
Lúcia Andrade
Rildo Aparecido Volpini
Antonio Carlos Seguro
author_facet Daniele Canale
Ana Carolina de Bragança
Janaína Garcia Gonçalves
Maria Heloisa Massola Shimizu
Talita Rojas Sanches
Lúcia Andrade
Rildo Aparecido Volpini
Antonio Carlos Seguro
author_sort Daniele Canale
collection DOAJ
description Vitamin D deficiency (VDD) is prevalent among HIV-infected individuals. Vitamin D has been associated with renal and cardiovascular diseases because of its effects on oxidative stress, lipid metabolism and renin-angiotensin-aldosterone system (RAAS). Tenofovir disoproxil fumarate (TDF), a widely used component of antiretroviral regimens for HIV treatment, can induce renal injury. The aim of this study was to investigate the effects of VDD on TDF-induced nephrotoxicity. Wistar rats were divided into four groups: control, receiving a standard diet for 60 days; VDD, receiving a vitamin D-free diet for 60 days; TDF, receiving a standard diet for 60 days with the addition of TDF (50 mg/kg food) for the last 30 days; and VDD+TDF receiving a vitamin D-free diet for 60 days with the addition of TDF for the last 30 days. TDF led to impaired renal function, hyperphosphaturia, hypophosphatemia, hypertension and increased renal vascular resistance due to downregulation of the sodium-phosphorus cotransporter and upregulation of angiotensin II and AT1 receptor. TDF also increased oxidative stress, as evidenced by higher TBARS and lower GSH levels, and induced dyslipidemia. Association of TDF and VDD aggravated renovascular effects and TDF-induced nephrotoxicity due to changes in the redox state and involvement of RAAS.
first_indexed 2024-12-10T21:03:27Z
format Article
id doaj.art-ddc1acffc22d41698b714879fdff228a
institution Directory Open Access Journal
issn 1932-6203
language English
last_indexed 2024-12-10T21:03:27Z
publishDate 2014-01-01
publisher Public Library of Science (PLoS)
record_format Article
series PLoS ONE
spelling doaj.art-ddc1acffc22d41698b714879fdff228a2022-12-22T01:33:44ZengPublic Library of Science (PLoS)PLoS ONE1932-62032014-01-0197e10305510.1371/journal.pone.0103055Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system.Daniele CanaleAna Carolina de BragançaJanaína Garcia GonçalvesMaria Heloisa Massola ShimizuTalita Rojas SanchesLúcia AndradeRildo Aparecido VolpiniAntonio Carlos SeguroVitamin D deficiency (VDD) is prevalent among HIV-infected individuals. Vitamin D has been associated with renal and cardiovascular diseases because of its effects on oxidative stress, lipid metabolism and renin-angiotensin-aldosterone system (RAAS). Tenofovir disoproxil fumarate (TDF), a widely used component of antiretroviral regimens for HIV treatment, can induce renal injury. The aim of this study was to investigate the effects of VDD on TDF-induced nephrotoxicity. Wistar rats were divided into four groups: control, receiving a standard diet for 60 days; VDD, receiving a vitamin D-free diet for 60 days; TDF, receiving a standard diet for 60 days with the addition of TDF (50 mg/kg food) for the last 30 days; and VDD+TDF receiving a vitamin D-free diet for 60 days with the addition of TDF for the last 30 days. TDF led to impaired renal function, hyperphosphaturia, hypophosphatemia, hypertension and increased renal vascular resistance due to downregulation of the sodium-phosphorus cotransporter and upregulation of angiotensin II and AT1 receptor. TDF also increased oxidative stress, as evidenced by higher TBARS and lower GSH levels, and induced dyslipidemia. Association of TDF and VDD aggravated renovascular effects and TDF-induced nephrotoxicity due to changes in the redox state and involvement of RAAS.http://europepmc.org/articles/PMC4105615?pdf=render
spellingShingle Daniele Canale
Ana Carolina de Bragança
Janaína Garcia Gonçalves
Maria Heloisa Massola Shimizu
Talita Rojas Sanches
Lúcia Andrade
Rildo Aparecido Volpini
Antonio Carlos Seguro
Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system.
PLoS ONE
title Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system.
title_full Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system.
title_fullStr Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system.
title_full_unstemmed Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system.
title_short Vitamin D deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system.
title_sort vitamin d deficiency aggravates nephrotoxicity hypertension and dyslipidemia caused by tenofovir role of oxidative stress and renin angiotensin system
url http://europepmc.org/articles/PMC4105615?pdf=render
work_keys_str_mv AT danielecanale vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT anacarolinadebraganca vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT janainagarciagoncalves vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT mariaheloisamassolashimizu vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT talitarojassanches vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT luciaandrade vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT rildoaparecidovolpini vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT antoniocarlosseguro vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem