In silico analysis of epitope-based CadF vaccine design against Campylobacter jejuni
Abstract Objective Vaccination is an important strategy for the eradication of infectious diseases. CadF protein of Campylobacter jejuni is one of the important factors in the pathogenesis of this bacterium. The purpose of this work was to perform a bioinformatics study to identify an epitope-based...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
BMC
2020-11-01
|
| Series: | BMC Research Notes |
| Subjects: | |
| Online Access: | http://link.springer.com/article/10.1186/s13104-020-05364-z |
| _version_ | 1818256057403703296 |
|---|---|
| author | Mona Moballegh Naseri Saeed Shams Mohammad Moballegh Naseri Bita Bakhshi |
| author_facet | Mona Moballegh Naseri Saeed Shams Mohammad Moballegh Naseri Bita Bakhshi |
| author_sort | Mona Moballegh Naseri |
| collection | DOAJ |
| description | Abstract Objective Vaccination is an important strategy for the eradication of infectious diseases. CadF protein of Campylobacter jejuni is one of the important factors in the pathogenesis of this bacterium. The purpose of this work was to perform a bioinformatics study to identify an epitope-based CadF vaccine, as a subunit vaccine. Full protein sequences of CadF were extracted from the NCBI and UniProt databases and subjected to in silico evaluations, including sequence analysis, allergenicity, antigenicity, epitope conservancy, and molecular docking assessments done by different servers. Results The results showed that CadF was a highly conserved protein belonging to the outer member proteins superfamily. Among the evaluated epitopes, LSDSLALRL was identified as an antigenic and non-allergenic peptide with a suitable structure for vaccine development. It was also able to stimulate both T and B cells. This 9-mer peptide was located in 136–144 segment of CadF protein and interacted with both HLA-A 0101 and HLA-DRB1 0101 alleles. Overall, the obtained theoretical results showed that CadF protein could be used for designing and evaluating a new effective vaccine against C. jejuni. |
| first_indexed | 2024-12-12T17:21:42Z |
| format | Article |
| id | doaj.art-e1fa7721eba14098a60b269ddcd7defa |
| institution | Directory Open Access Journal |
| issn | 1756-0500 |
| language | English |
| last_indexed | 2024-12-12T17:21:42Z |
| publishDate | 2020-11-01 |
| publisher | BMC |
| record_format | Article |
| series | BMC Research Notes |
| spelling | doaj.art-e1fa7721eba14098a60b269ddcd7defa2022-12-22T00:17:39ZengBMCBMC Research Notes1756-05002020-11-011311610.1186/s13104-020-05364-zIn silico analysis of epitope-based CadF vaccine design against Campylobacter jejuniMona Moballegh Naseri0Saeed Shams1Mohammad Moballegh Naseri2Bita Bakhshi3Cellular and Molecular Research Center, Qom University of Medical SciencesCellular and Molecular Research Center, Qom University of Medical SciencesDepartment of Computer and IT, Shahab-Danesh UniversityDepartment of Bacteriology, Faculty of Medical Sciences, Tarbiat Modares UniversityAbstract Objective Vaccination is an important strategy for the eradication of infectious diseases. CadF protein of Campylobacter jejuni is one of the important factors in the pathogenesis of this bacterium. The purpose of this work was to perform a bioinformatics study to identify an epitope-based CadF vaccine, as a subunit vaccine. Full protein sequences of CadF were extracted from the NCBI and UniProt databases and subjected to in silico evaluations, including sequence analysis, allergenicity, antigenicity, epitope conservancy, and molecular docking assessments done by different servers. Results The results showed that CadF was a highly conserved protein belonging to the outer member proteins superfamily. Among the evaluated epitopes, LSDSLALRL was identified as an antigenic and non-allergenic peptide with a suitable structure for vaccine development. It was also able to stimulate both T and B cells. This 9-mer peptide was located in 136–144 segment of CadF protein and interacted with both HLA-A 0101 and HLA-DRB1 0101 alleles. Overall, the obtained theoretical results showed that CadF protein could be used for designing and evaluating a new effective vaccine against C. jejuni.http://link.springer.com/article/10.1186/s13104-020-05364-zCampylobacter jejuniVaccineCadFIn SilicoBioinformaticsEpitope |
| spellingShingle | Mona Moballegh Naseri Saeed Shams Mohammad Moballegh Naseri Bita Bakhshi In silico analysis of epitope-based CadF vaccine design against Campylobacter jejuni BMC Research Notes Campylobacter jejuni Vaccine CadF In Silico Bioinformatics Epitope |
| title | In silico analysis of epitope-based CadF vaccine design against Campylobacter jejuni |
| title_full | In silico analysis of epitope-based CadF vaccine design against Campylobacter jejuni |
| title_fullStr | In silico analysis of epitope-based CadF vaccine design against Campylobacter jejuni |
| title_full_unstemmed | In silico analysis of epitope-based CadF vaccine design against Campylobacter jejuni |
| title_short | In silico analysis of epitope-based CadF vaccine design against Campylobacter jejuni |
| title_sort | in silico analysis of epitope based cadf vaccine design against campylobacter jejuni |
| topic | Campylobacter jejuni Vaccine CadF In Silico Bioinformatics Epitope |
| url | http://link.springer.com/article/10.1186/s13104-020-05364-z |
| work_keys_str_mv | AT monamoballeghnaseri insilicoanalysisofepitopebasedcadfvaccinedesignagainstcampylobacterjejuni AT saeedshams insilicoanalysisofepitopebasedcadfvaccinedesignagainstcampylobacterjejuni AT mohammadmoballeghnaseri insilicoanalysisofepitopebasedcadfvaccinedesignagainstcampylobacterjejuni AT bitabakhshi insilicoanalysisofepitopebasedcadfvaccinedesignagainstcampylobacterjejuni |