Correlation between Ankle Imaging Findings and Self-Reported Outcomes: A Longitudinal Assessment in Patients with Tibiofibular Diastasis
Background and Objectives: This longitudinal study investigated the correlation between imaging findings and self-reported questionnaire outcomes in patients with tibiofibular diastasis, exploring the effects of surgical screw removal versus conservative treatment. This study was conducted at “Victo...
| Main Authors: | , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2023-11-01
|
| Series: | Journal of Clinical Medicine |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2077-0383/12/23/7239 |
| _version_ | 1797400009971335168 |
|---|---|
| author | Samer Hosin Dinu Vermesan Bogdan Deleanu Daniel Pop Dan Crisan Musab Al-Qatawneh Mihai Mioc Cosmin Faur Ovidiu Rosca Radu Prejbeanu |
| author_facet | Samer Hosin Dinu Vermesan Bogdan Deleanu Daniel Pop Dan Crisan Musab Al-Qatawneh Mihai Mioc Cosmin Faur Ovidiu Rosca Radu Prejbeanu |
| author_sort | Samer Hosin |
| collection | DOAJ |
| description | Background and Objectives: This longitudinal study investigated the correlation between imaging findings and self-reported questionnaire outcomes in patients with tibiofibular diastasis, exploring the effects of surgical screw removal versus conservative treatment. This study was conducted at “Victor Babes” University of Medicine and Pharmacy in Timisoara between 2018 and 2023. Materials and Methods: The study involved 85 patients in the screw removal group and 44 in the conservative group, assessed at 2 and 6 months post-surgery, answering the SF-36, HADS, and WHOQOL questionnaires. Results: Significant differences were observed at 2 months post-surgery, with the screw removal group showing lower shear wave velocities in ankle dorsiflexion (8.9 ± 1.4) and anterior talofibular ligament (2.8 ± 0.9), indicating better mobility compared to the conservative group (ankle dorsiflexion: 10.1 ± 1.8, ATFL: 3.2 ± 1.1). Radiographically, lower tibiofibular overlap (8.1 ± 2.1) in the screw removal group suggested improved joint fixation quality. These physical improvements were mirrored in the quality-of-life assessments, where the screw removal group reported higher physical health scores on the SF-36 survey at 2 months, a trend that continued at 6 months. At 2 months, ankle dorsiflexion demonstrated a strong negative correlation with the SF-36 Physical score (r = −0.417) and WHOQOL Physical domain (r = −0.394), and a positive correlation with HADS Anxiety (r = 0.312). Similarly, ATFL and CFL velocities negatively correlated with the SF-36 Physical score (ATFL: r = −0.251; CFL: r = −0.237). Radiographic tibiofibular overlap and clear space positively correlated with WHOQOL Physical domain (TOL: r = 0.291; TCS: r = 0.276), with TCS also negatively correlating with HADS Anxiety (r = −0.228). At 6 months, these correlations persisted, with notable negative correlations between ultrasound ankle dorsiflexion and both SF-36 Physical score and WHOQOL Physical domain. Conclusions: These findings underscore the advantages of screw removal in enhancing physical recovery and reducing anxiety in the short term, while indicating similar long-term mental health outcomes between treatment approaches. |
| first_indexed | 2024-03-09T01:49:21Z |
| format | Article |
| id | doaj.art-e231a0bc02a24bfba39a0dea035e1ce0 |
| institution | Directory Open Access Journal |
| issn | 2077-0383 |
| language | English |
| last_indexed | 2024-03-09T01:49:21Z |
| publishDate | 2023-11-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Journal of Clinical Medicine |
| spelling | doaj.art-e231a0bc02a24bfba39a0dea035e1ce02023-12-08T15:18:48ZengMDPI AGJournal of Clinical Medicine2077-03832023-11-011223723910.3390/jcm12237239Correlation between Ankle Imaging Findings and Self-Reported Outcomes: A Longitudinal Assessment in Patients with Tibiofibular DiastasisSamer Hosin0Dinu Vermesan1Bogdan Deleanu2Daniel Pop3Dan Crisan4Musab Al-Qatawneh5Mihai Mioc6Cosmin Faur7Ovidiu Rosca8Radu Prejbeanu9Department of Orthopedics, “Victor Babes” University of Medicine and Pharmacy Timisoara, 300041 Timisoara, RomaniaDepartment of Orthopedics, “Victor Babes” University of Medicine and Pharmacy Timisoara, 300041 Timisoara, RomaniaDepartment of Orthopedics, “Victor Babes” University of Medicine and Pharmacy Timisoara, 300041 Timisoara, RomaniaDepartment of Orthopedics, “Victor Babes” University of Medicine and Pharmacy Timisoara, 300041 Timisoara, RomaniaDepartment of Orthopedics, “Victor Babes” University of Medicine and Pharmacy Timisoara, 300041 Timisoara, RomaniaDepartment of Orthopedics, “Victor Babes” University of Medicine and Pharmacy Timisoara, 300041 Timisoara, RomaniaDepartment of Orthopedics, “Victor Babes” University of Medicine and Pharmacy Timisoara, 300041 Timisoara, RomaniaDepartment of Orthopedics, “Victor Babes” University of Medicine and Pharmacy Timisoara, 300041 Timisoara, RomaniaDepartment of Infectious Diseases, “Victor Babes” University of Medicine and Pharmacy Timisoara, Eftimie Murgu Square 2, 300041 Timisoara, RomaniaDepartment of Orthopedics, “Victor Babes” University of Medicine and Pharmacy Timisoara, 300041 Timisoara, RomaniaBackground and Objectives: This longitudinal study investigated the correlation between imaging findings and self-reported questionnaire outcomes in patients with tibiofibular diastasis, exploring the effects of surgical screw removal versus conservative treatment. This study was conducted at “Victor Babes” University of Medicine and Pharmacy in Timisoara between 2018 and 2023. Materials and Methods: The study involved 85 patients in the screw removal group and 44 in the conservative group, assessed at 2 and 6 months post-surgery, answering the SF-36, HADS, and WHOQOL questionnaires. Results: Significant differences were observed at 2 months post-surgery, with the screw removal group showing lower shear wave velocities in ankle dorsiflexion (8.9 ± 1.4) and anterior talofibular ligament (2.8 ± 0.9), indicating better mobility compared to the conservative group (ankle dorsiflexion: 10.1 ± 1.8, ATFL: 3.2 ± 1.1). Radiographically, lower tibiofibular overlap (8.1 ± 2.1) in the screw removal group suggested improved joint fixation quality. These physical improvements were mirrored in the quality-of-life assessments, where the screw removal group reported higher physical health scores on the SF-36 survey at 2 months, a trend that continued at 6 months. At 2 months, ankle dorsiflexion demonstrated a strong negative correlation with the SF-36 Physical score (r = −0.417) and WHOQOL Physical domain (r = −0.394), and a positive correlation with HADS Anxiety (r = 0.312). Similarly, ATFL and CFL velocities negatively correlated with the SF-36 Physical score (ATFL: r = −0.251; CFL: r = −0.237). Radiographic tibiofibular overlap and clear space positively correlated with WHOQOL Physical domain (TOL: r = 0.291; TCS: r = 0.276), with TCS also negatively correlating with HADS Anxiety (r = −0.228). At 6 months, these correlations persisted, with notable negative correlations between ultrasound ankle dorsiflexion and both SF-36 Physical score and WHOQOL Physical domain. Conclusions: These findings underscore the advantages of screw removal in enhancing physical recovery and reducing anxiety in the short term, while indicating similar long-term mental health outcomes between treatment approaches.https://www.mdpi.com/2077-0383/12/23/7239orthopedic procedurestibiofibular ankle syndesmosisankle fracturesquality of lifejoint range of motion |
| spellingShingle | Samer Hosin Dinu Vermesan Bogdan Deleanu Daniel Pop Dan Crisan Musab Al-Qatawneh Mihai Mioc Cosmin Faur Ovidiu Rosca Radu Prejbeanu Correlation between Ankle Imaging Findings and Self-Reported Outcomes: A Longitudinal Assessment in Patients with Tibiofibular Diastasis Journal of Clinical Medicine orthopedic procedures tibiofibular ankle syndesmosis ankle fractures quality of life joint range of motion |
| title | Correlation between Ankle Imaging Findings and Self-Reported Outcomes: A Longitudinal Assessment in Patients with Tibiofibular Diastasis |
| title_full | Correlation between Ankle Imaging Findings and Self-Reported Outcomes: A Longitudinal Assessment in Patients with Tibiofibular Diastasis |
| title_fullStr | Correlation between Ankle Imaging Findings and Self-Reported Outcomes: A Longitudinal Assessment in Patients with Tibiofibular Diastasis |
| title_full_unstemmed | Correlation between Ankle Imaging Findings and Self-Reported Outcomes: A Longitudinal Assessment in Patients with Tibiofibular Diastasis |
| title_short | Correlation between Ankle Imaging Findings and Self-Reported Outcomes: A Longitudinal Assessment in Patients with Tibiofibular Diastasis |
| title_sort | correlation between ankle imaging findings and self reported outcomes a longitudinal assessment in patients with tibiofibular diastasis |
| topic | orthopedic procedures tibiofibular ankle syndesmosis ankle fractures quality of life joint range of motion |
| url | https://www.mdpi.com/2077-0383/12/23/7239 |
| work_keys_str_mv | AT samerhosin correlationbetweenankleimagingfindingsandselfreportedoutcomesalongitudinalassessmentinpatientswithtibiofibulardiastasis AT dinuvermesan correlationbetweenankleimagingfindingsandselfreportedoutcomesalongitudinalassessmentinpatientswithtibiofibulardiastasis AT bogdandeleanu correlationbetweenankleimagingfindingsandselfreportedoutcomesalongitudinalassessmentinpatientswithtibiofibulardiastasis AT danielpop correlationbetweenankleimagingfindingsandselfreportedoutcomesalongitudinalassessmentinpatientswithtibiofibulardiastasis AT dancrisan correlationbetweenankleimagingfindingsandselfreportedoutcomesalongitudinalassessmentinpatientswithtibiofibulardiastasis AT musabalqatawneh correlationbetweenankleimagingfindingsandselfreportedoutcomesalongitudinalassessmentinpatientswithtibiofibulardiastasis AT mihaimioc correlationbetweenankleimagingfindingsandselfreportedoutcomesalongitudinalassessmentinpatientswithtibiofibulardiastasis AT cosminfaur correlationbetweenankleimagingfindingsandselfreportedoutcomesalongitudinalassessmentinpatientswithtibiofibulardiastasis AT ovidiurosca correlationbetweenankleimagingfindingsandselfreportedoutcomesalongitudinalassessmentinpatientswithtibiofibulardiastasis AT raduprejbeanu correlationbetweenankleimagingfindingsandselfreportedoutcomesalongitudinalassessmentinpatientswithtibiofibulardiastasis |