Complete mitochondrial genome of the Hong Kong Dwarf Snake Calamaria septentrionalis Boulenger, 1890 (Reptilia: Colubridae)
The Hong Kong Dwarf Snake Calamaria septentrionalis Boulenger, 1890 is widely distributed in south of China and North of Vietnam. The complete mitochondrial genome (mitogenome) sequence of C. septentrionalis was determined by shotgun sequencing. The mitogenome of C. septentrionalis is 17,053 bp in l...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Taylor & Francis Group
2020-07-01
|
| Series: | Mitochondrial DNA. Part B. Resources |
| Subjects: | |
| Online Access: | http://dx.doi.org/10.1080/23802359.2020.1781569 |
| _version_ | 1827772811682250752 |
|---|---|
| author | Li-Zhong Yao Yan-An Gong Xin-Sheng Tang |
| author_facet | Li-Zhong Yao Yan-An Gong Xin-Sheng Tang |
| author_sort | Li-Zhong Yao |
| collection | DOAJ |
| description | The Hong Kong Dwarf Snake Calamaria septentrionalis Boulenger, 1890 is widely distributed in south of China and North of Vietnam. The complete mitochondrial genome (mitogenome) sequence of C. septentrionalis was determined by shotgun sequencing. The mitogenome of C. septentrionalis is 17,053 bp in length and contains two ribosome RNA genes, 13 protein-coding genes, 22 tRNA genes, and two noncoding regions. Most genes of C. septentrionalis were distributed on the H-strand, except for the ND6 subunit gene and eight tRNA genes which were encoded on the L-strand. The phylogenetic tree of C. septentrionalis and 15 other related species was built. The DNA data presented here will be useful to study the evolutionary relationships and genetic diversity of C. septentrionalis. |
| first_indexed | 2024-03-11T13:14:10Z |
| format | Article |
| id | doaj.art-e8fd77d4a5ed4e99b6f19a025005e48b |
| institution | Directory Open Access Journal |
| issn | 2380-2359 |
| language | English |
| last_indexed | 2024-03-11T13:14:10Z |
| publishDate | 2020-07-01 |
| publisher | Taylor & Francis Group |
| record_format | Article |
| series | Mitochondrial DNA. Part B. Resources |
| spelling | doaj.art-e8fd77d4a5ed4e99b6f19a025005e48b2023-11-03T14:00:30ZengTaylor & Francis GroupMitochondrial DNA. Part B. Resources2380-23592020-07-01532580258110.1080/23802359.2020.17815691781569Complete mitochondrial genome of the Hong Kong Dwarf Snake Calamaria septentrionalis Boulenger, 1890 (Reptilia: Colubridae)Li-Zhong Yao0Yan-An Gong1Xin-Sheng Tang2School of Tourism, Huangshan UniversityCollege of Life and Environment Sciences, Huangshan UniversityCollege of Life and Environment Sciences, Huangshan UniversityThe Hong Kong Dwarf Snake Calamaria septentrionalis Boulenger, 1890 is widely distributed in south of China and North of Vietnam. The complete mitochondrial genome (mitogenome) sequence of C. septentrionalis was determined by shotgun sequencing. The mitogenome of C. septentrionalis is 17,053 bp in length and contains two ribosome RNA genes, 13 protein-coding genes, 22 tRNA genes, and two noncoding regions. Most genes of C. septentrionalis were distributed on the H-strand, except for the ND6 subunit gene and eight tRNA genes which were encoded on the L-strand. The phylogenetic tree of C. septentrionalis and 15 other related species was built. The DNA data presented here will be useful to study the evolutionary relationships and genetic diversity of C. septentrionalis.http://dx.doi.org/10.1080/23802359.2020.1781569calamaria septentrionalismitochondrial genomephylogenydabie mountains |
| spellingShingle | Li-Zhong Yao Yan-An Gong Xin-Sheng Tang Complete mitochondrial genome of the Hong Kong Dwarf Snake Calamaria septentrionalis Boulenger, 1890 (Reptilia: Colubridae) Mitochondrial DNA. Part B. Resources calamaria septentrionalis mitochondrial genome phylogeny dabie mountains |
| title | Complete mitochondrial genome of the Hong Kong Dwarf Snake Calamaria septentrionalis Boulenger, 1890 (Reptilia: Colubridae) |
| title_full | Complete mitochondrial genome of the Hong Kong Dwarf Snake Calamaria septentrionalis Boulenger, 1890 (Reptilia: Colubridae) |
| title_fullStr | Complete mitochondrial genome of the Hong Kong Dwarf Snake Calamaria septentrionalis Boulenger, 1890 (Reptilia: Colubridae) |
| title_full_unstemmed | Complete mitochondrial genome of the Hong Kong Dwarf Snake Calamaria septentrionalis Boulenger, 1890 (Reptilia: Colubridae) |
| title_short | Complete mitochondrial genome of the Hong Kong Dwarf Snake Calamaria septentrionalis Boulenger, 1890 (Reptilia: Colubridae) |
| title_sort | complete mitochondrial genome of the hong kong dwarf snake calamaria septentrionalis boulenger 1890 reptilia colubridae |
| topic | calamaria septentrionalis mitochondrial genome phylogeny dabie mountains |
| url | http://dx.doi.org/10.1080/23802359.2020.1781569 |
| work_keys_str_mv | AT lizhongyao completemitochondrialgenomeofthehongkongdwarfsnakecalamariaseptentrionalisboulenger1890reptiliacolubridae AT yanangong completemitochondrialgenomeofthehongkongdwarfsnakecalamariaseptentrionalisboulenger1890reptiliacolubridae AT xinshengtang completemitochondrialgenomeofthehongkongdwarfsnakecalamariaseptentrionalisboulenger1890reptiliacolubridae |