The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China
Carex agglomerata C. B. Clarke is a sedge with excellent ornamental characters, it is an important ecosystem stabilizer. Here we report the complete chloroplast genome of C. agglomerata to provide a foundation for further phylogenetic studies on the Cyperaceae. The chloroplast (cp) genome is 184,157...
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Taylor & Francis Group
2021-11-01
|
| Series: | Mitochondrial DNA. Part B. Resources |
| Subjects: | |
| Online Access: | http://dx.doi.org/10.1080/23802359.2021.1984326 |
| _version_ | 1797638752542130176 |
|---|---|
| author | Lu-Lu Xun Fang-Bin Ding Chen Chen Pei-Liang Liu Yuan Lu Ya-Fu Zhou Ya-Wei Zhang Si-Feng Li |
| author_facet | Lu-Lu Xun Fang-Bin Ding Chen Chen Pei-Liang Liu Yuan Lu Ya-Fu Zhou Ya-Wei Zhang Si-Feng Li |
| author_sort | Lu-Lu Xun |
| collection | DOAJ |
| description | Carex agglomerata C. B. Clarke is a sedge with excellent ornamental characters, it is an important ecosystem stabilizer. Here we report the complete chloroplast genome of C. agglomerata to provide a foundation for further phylogenetic studies on the Cyperaceae. The chloroplast (cp) genome is 184,157 bp in size and consists of a large single-copy (LSC) region 106,654 bp in length, a small single-copy (SSC) region of 36,099 bp, two inverted repeats (IR) regions each 20,702 bp. The total GC content of the cp genome is 33.9% with the LSC, SSC, and IR regions 32, 32.5, and 42.9%, respectively. The cp genome contains 128 genes, including 80 protein-coding, 40 tRNA, and eight rRNA genes. The phylogenetic analysis showed C. agglomerata is in a clade with Carex neurocarpa Maxim and Carex siderosticta Hance. This study provides a basis for further phylogenetic studies of Carex. |
| first_indexed | 2024-03-11T13:07:59Z |
| format | Article |
| id | doaj.art-eb11f7989e5f4c029e39af5bc108158d |
| institution | Directory Open Access Journal |
| issn | 2380-2359 |
| language | English |
| last_indexed | 2024-03-11T13:07:59Z |
| publishDate | 2021-11-01 |
| publisher | Taylor & Francis Group |
| record_format | Article |
| series | Mitochondrial DNA. Part B. Resources |
| spelling | doaj.art-eb11f7989e5f4c029e39af5bc108158d2023-11-03T14:28:31ZengTaylor & Francis GroupMitochondrial DNA. Part B. Resources2380-23592021-11-016113117311810.1080/23802359.2021.19843261984326The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from ChinaLu-Lu Xun0Fang-Bin Ding1Chen Chen2Pei-Liang Liu3Yuan Lu4Ya-Fu Zhou5Ya-Wei Zhang6Si-Feng Li7Xi’an Botanical Garden of Shaanxi Province, Institute of Botany of Shaanxi Province, Shaanxi Engineering Research Centre for Conservation and Utilization of Botanical ResourcesXi’an Botanical Garden of Shaanxi Province, Institute of Botany of Shaanxi Province, Shaanxi Engineering Research Centre for Conservation and Utilization of Botanical ResourcesXi’an Botanical Garden of Shaanxi Province, Institute of Botany of Shaanxi Province, Shaanxi Engineering Research Centre for Conservation and Utilization of Botanical ResourcesCollege of Life Sciences, Northwest UniversityXi’an Botanical Garden of Shaanxi Province, Institute of Botany of Shaanxi Province, Shaanxi Engineering Research Centre for Conservation and Utilization of Botanical ResourcesXi’an Botanical Garden of Shaanxi Province, Institute of Botany of Shaanxi Province, Shaanxi Engineering Research Centre for Conservation and Utilization of Botanical ResourcesBaoji Animal Husbandry and Veterinary CenterXi’an Botanical Garden of Shaanxi Province, Institute of Botany of Shaanxi Province, Shaanxi Engineering Research Centre for Conservation and Utilization of Botanical ResourcesCarex agglomerata C. B. Clarke is a sedge with excellent ornamental characters, it is an important ecosystem stabilizer. Here we report the complete chloroplast genome of C. agglomerata to provide a foundation for further phylogenetic studies on the Cyperaceae. The chloroplast (cp) genome is 184,157 bp in size and consists of a large single-copy (LSC) region 106,654 bp in length, a small single-copy (SSC) region of 36,099 bp, two inverted repeats (IR) regions each 20,702 bp. The total GC content of the cp genome is 33.9% with the LSC, SSC, and IR regions 32, 32.5, and 42.9%, respectively. The cp genome contains 128 genes, including 80 protein-coding, 40 tRNA, and eight rRNA genes. The phylogenetic analysis showed C. agglomerata is in a clade with Carex neurocarpa Maxim and Carex siderosticta Hance. This study provides a basis for further phylogenetic studies of Carex.http://dx.doi.org/10.1080/23802359.2021.1984326carex agglomeratachloroplast genome phylogenetic analysis sequencing |
| spellingShingle | Lu-Lu Xun Fang-Bin Ding Chen Chen Pei-Liang Liu Yuan Lu Ya-Fu Zhou Ya-Wei Zhang Si-Feng Li The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China Mitochondrial DNA. Part B. Resources carex agglomerata chloroplast genome phylogenetic analysis sequencing |
| title | The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China |
| title_full | The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China |
| title_fullStr | The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China |
| title_full_unstemmed | The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China |
| title_short | The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China |
| title_sort | complete chloroplast genome of carex agglomerata c b clarke cyperaceae an endemic species from china |
| topic | carex agglomerata chloroplast genome phylogenetic analysis sequencing |
| url | http://dx.doi.org/10.1080/23802359.2021.1984326 |
| work_keys_str_mv | AT luluxun thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT fangbinding thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT chenchen thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT peiliangliu thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT yuanlu thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT yafuzhou thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT yaweizhang thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT sifengli thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT luluxun completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT fangbinding completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT chenchen completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT peiliangliu completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT yuanlu completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT yafuzhou completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT yaweizhang completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT sifengli completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina |