Acetylcholine Esterase Gene Expression in Salivary Glands of Albino Rats after Treatment with amitriptyline or/and Ashwagandha
Acetylcholinesterase is required as an enzyme to counteract the effects of acetylcholine. The aim of the study is to assess how amitriptyline and Ashwagandha affect the acetylcholinesterase gene in rat salivary glands. Forty healthy albino rats were divided randomly into four equal groups: Group I (...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Egyptian Society for Animal Management
2023-01-01
|
| Series: | Journal of Applied Veterinary Sciences |
| Subjects: | |
| Online Access: | https://javs.journals.ekb.eg/article_274069.html |
| _version_ | 1797970968889524224 |
|---|---|
| author | Ismail R. Idrees Ghada A. Taqa Saba Kh. A. Ibrahim |
| author_facet | Ismail R. Idrees Ghada A. Taqa Saba Kh. A. Ibrahim |
| author_sort | Ismail R. Idrees |
| collection | DOAJ |
| description | Acetylcholinesterase is required as an enzyme to counteract the effects of acetylcholine. The aim of the study is to assess how amitriptyline and Ashwagandha affect the acetylcholinesterase gene in rat salivary glands. Forty healthy albino rats were divided randomly into four equal groups: Group I (control) received distilled water for 30 days. Group II received amitriptyline (10mg/kg) for 30 days. Group III received ashwagandha watery root extract (200mg/kg) orally for 30 days and Group IV received the combination of amitriptyline orally and ashwagandha root extract orally for 30 days. Rats in each group were sacrificed after day 30 and salivary glands were dissected for measurement of the acetylcholinesterase gene using a Polymerase Chain Reaction technique (PCR). Acetylcholinesterase gene measurements reveal an increase in groups treated with amitriptyline alone (1.55±0.11) and in the group treated with a combination of amitriptyline with Ashwagandha (1.92±0.16), in comparison with the control group. There were no discernible differences between the Ashwagandha treated group (1.073± 0.25) compared to the control group (0.76±0.19).In conclusion, Amitriptyline alone and, when combined with Ashwagandha cause transcription of the acetylcholinesterase gene. |
| first_indexed | 2024-04-11T03:25:18Z |
| format | Article |
| id | doaj.art-f1f0c972e1b1472aad41aa77a52a1bf9 |
| institution | Directory Open Access Journal |
| issn | 1687-4072 2090-3308 |
| language | English |
| last_indexed | 2024-04-11T03:25:18Z |
| publishDate | 2023-01-01 |
| publisher | Egyptian Society for Animal Management |
| record_format | Article |
| series | Journal of Applied Veterinary Sciences |
| spelling | doaj.art-f1f0c972e1b1472aad41aa77a52a1bf92023-01-02T07:59:16ZengEgyptian Society for Animal ManagementJournal of Applied Veterinary Sciences1687-40722090-33082023-01-0181727710.21608/JAVS.2022.173225.1191Acetylcholine Esterase Gene Expression in Salivary Glands of Albino Rats after Treatment with amitriptyline or/and AshwagandhaIsmail R. Idrees 0https://orcid.org/0000-0003-0188-973XGhada A. Taqa 1Saba Kh. A. Ibrahim2https://orcid.org/0000-0001-7056-9591Ministry of Health, Ninevah Health Directorate, Mosul, IraqDepartment of Dental Basic Sciences, College of Dentistry. University of Mosul, Mosul, IraqDepartment of Dental Basic Sciences, College of Dentistry. University of Mosul, Mosul, IraqAcetylcholinesterase is required as an enzyme to counteract the effects of acetylcholine. The aim of the study is to assess how amitriptyline and Ashwagandha affect the acetylcholinesterase gene in rat salivary glands. Forty healthy albino rats were divided randomly into four equal groups: Group I (control) received distilled water for 30 days. Group II received amitriptyline (10mg/kg) for 30 days. Group III received ashwagandha watery root extract (200mg/kg) orally for 30 days and Group IV received the combination of amitriptyline orally and ashwagandha root extract orally for 30 days. Rats in each group were sacrificed after day 30 and salivary glands were dissected for measurement of the acetylcholinesterase gene using a Polymerase Chain Reaction technique (PCR). Acetylcholinesterase gene measurements reveal an increase in groups treated with amitriptyline alone (1.55±0.11) and in the group treated with a combination of amitriptyline with Ashwagandha (1.92±0.16), in comparison with the control group. There were no discernible differences between the Ashwagandha treated group (1.073± 0.25) compared to the control group (0.76±0.19).In conclusion, Amitriptyline alone and, when combined with Ashwagandha cause transcription of the acetylcholinesterase gene. https://javs.journals.ekb.eg/article_274069.htmlacetylcholinesterase geneamitriptylineashwagandhasalivary glands |
| spellingShingle | Ismail R. Idrees Ghada A. Taqa Saba Kh. A. Ibrahim Acetylcholine Esterase Gene Expression in Salivary Glands of Albino Rats after Treatment with amitriptyline or/and Ashwagandha Journal of Applied Veterinary Sciences acetylcholinesterase gene amitriptyline ashwagandha salivary glands |
| title | Acetylcholine Esterase Gene Expression in Salivary Glands of Albino Rats after Treatment with amitriptyline or/and Ashwagandha |
| title_full | Acetylcholine Esterase Gene Expression in Salivary Glands of Albino Rats after Treatment with amitriptyline or/and Ashwagandha |
| title_fullStr | Acetylcholine Esterase Gene Expression in Salivary Glands of Albino Rats after Treatment with amitriptyline or/and Ashwagandha |
| title_full_unstemmed | Acetylcholine Esterase Gene Expression in Salivary Glands of Albino Rats after Treatment with amitriptyline or/and Ashwagandha |
| title_short | Acetylcholine Esterase Gene Expression in Salivary Glands of Albino Rats after Treatment with amitriptyline or/and Ashwagandha |
| title_sort | acetylcholine esterase gene expression in salivary glands of albino rats after treatment with amitriptyline or and ashwagandha |
| topic | acetylcholinesterase gene amitriptyline ashwagandha salivary glands |
| url | https://javs.journals.ekb.eg/article_274069.html |
| work_keys_str_mv | AT ismailridrees acetylcholineesterasegeneexpressioninsalivaryglandsofalbinoratsaftertreatmentwithamitriptylineorandashwagandha AT ghadaataqa acetylcholineesterasegeneexpressioninsalivaryglandsofalbinoratsaftertreatmentwithamitriptylineorandashwagandha AT sabakhaibrahim acetylcholineesterasegeneexpressioninsalivaryglandsofalbinoratsaftertreatmentwithamitriptylineorandashwagandha |