Unidirectional propagation of magnetostatic surface spin waves at a magnetic film surface
An analytical expression for the amplitudes of magnetostatic surface spin waves (MSSWs) propagating in opposite directions at a magnetic film surface is presented. This shows that for a given magnetic field H, it is forbidden for an independent MSSW to propagate along the direction of -[arrow over H...
| Main Authors: | , , , , , , , , |
|---|---|
| Other Authors: | |
| Format: | Article |
| Language: | en_US |
| Published: |
American Institute of Physics (AIP)
2016
|
| Online Access: | http://hdl.handle.net/1721.1/102185 https://orcid.org/0000-0003-2262-1249 |
| _version_ | 1826217118256857088 |
|---|---|
| author | Wong, Kin L. Bi, Lei Bao, Mingqiang Wen, Qiye Chatelon, Jean Pierre Lin, Yen-Ting Zhang, Huaiwu Wang, Kang L. Ross, Caroline A. |
| author2 | Massachusetts Institute of Technology. Department of Materials Science and Engineering |
| author_facet | Massachusetts Institute of Technology. Department of Materials Science and Engineering Wong, Kin L. Bi, Lei Bao, Mingqiang Wen, Qiye Chatelon, Jean Pierre Lin, Yen-Ting Zhang, Huaiwu Wang, Kang L. Ross, Caroline A. |
| author_sort | Wong, Kin L. |
| collection | MIT |
| description | An analytical expression for the amplitudes of magnetostatic surface spin waves (MSSWs) propagating in opposite directions at a magnetic film surface is presented. This shows that for a given magnetic field H, it is forbidden for an independent MSSW to propagate along the direction of -[arrow over H] x -[arrow overn] where [arrow over n] is the surface normal. This unidirectional propagation property is confirmed by experiments with both permalloy and yttrium iron garnet films of different film thicknesses, and has implications in the design of spin-wave devices such as isolators and spin-wave diodes. |
| first_indexed | 2024-09-23T16:58:18Z |
| format | Article |
| id | mit-1721.1/102185 |
| institution | Massachusetts Institute of Technology |
| language | en_US |
| last_indexed | 2024-09-23T16:58:18Z |
| publishDate | 2016 |
| publisher | American Institute of Physics (AIP) |
| record_format | dspace |
| spelling | mit-1721.1/1021852022-09-29T22:46:48Z Unidirectional propagation of magnetostatic surface spin waves at a magnetic film surface Wong, Kin L. Bi, Lei Bao, Mingqiang Wen, Qiye Chatelon, Jean Pierre Lin, Yen-Ting Zhang, Huaiwu Wang, Kang L. Ross, Caroline A. Massachusetts Institute of Technology. Department of Materials Science and Engineering Bi, Lei Ross, Caroline A. An analytical expression for the amplitudes of magnetostatic surface spin waves (MSSWs) propagating in opposite directions at a magnetic film surface is presented. This shows that for a given magnetic field H, it is forbidden for an independent MSSW to propagate along the direction of -[arrow over H] x -[arrow overn] where [arrow over n] is the surface normal. This unidirectional propagation property is confirmed by experiments with both permalloy and yttrium iron garnet films of different film thicknesses, and has implications in the design of spin-wave devices such as isolators and spin-wave diodes. National Science Foundation (U.S.) Intel Corporation (Fellowship) United States. Defense Advanced Research Projects Agency. NVL Program National Natural Science Foundation (China) (61131005) Western Institute of Nanoelectronics. Nanoelectronics Research Initiative University of California, Los Angeles. Center on Functional Engineered Nano Architectonics 2016-04-06T17:53:35Z 2016-04-06T17:53:35Z 2014-12 2014-09 Article http://purl.org/eprint/type/JournalArticle 0003-6951 1077-3118 http://hdl.handle.net/1721.1/102185 Wong, Kin L., Lei Bi, Mingqiang Bao, Qiye Wen, Jean Pierre Chatelon, Yen-Ting Lin, C. A. Ross, Huaiwu Zhang, and Kang L. Wang. “Unidirectional Propagation of Magnetostatic Surface Spin Waves at a Magnetic Film Surface.” Applied Physics Letters 105, no. 23 (December 8, 2014): 232403. © 2014 AIP Publishing LLC https://orcid.org/0000-0003-2262-1249 en_US http://dx.doi.org/10.1063/1.4903742 Applied Physics Letters Article is made available in accordance with the publisher's policy and may be subject to US copyright law. Please refer to the publisher's site for terms of use. application/pdf American Institute of Physics (AIP) Other univ. web domain |
| spellingShingle | Wong, Kin L. Bi, Lei Bao, Mingqiang Wen, Qiye Chatelon, Jean Pierre Lin, Yen-Ting Zhang, Huaiwu Wang, Kang L. Ross, Caroline A. Unidirectional propagation of magnetostatic surface spin waves at a magnetic film surface |
| title | Unidirectional propagation of magnetostatic surface spin waves at a magnetic film surface |
| title_full | Unidirectional propagation of magnetostatic surface spin waves at a magnetic film surface |
| title_fullStr | Unidirectional propagation of magnetostatic surface spin waves at a magnetic film surface |
| title_full_unstemmed | Unidirectional propagation of magnetostatic surface spin waves at a magnetic film surface |
| title_short | Unidirectional propagation of magnetostatic surface spin waves at a magnetic film surface |
| title_sort | unidirectional propagation of magnetostatic surface spin waves at a magnetic film surface |
| url | http://hdl.handle.net/1721.1/102185 https://orcid.org/0000-0003-2262-1249 |
| work_keys_str_mv | AT wongkinl unidirectionalpropagationofmagnetostaticsurfacespinwavesatamagneticfilmsurface AT bilei unidirectionalpropagationofmagnetostaticsurfacespinwavesatamagneticfilmsurface AT baomingqiang unidirectionalpropagationofmagnetostaticsurfacespinwavesatamagneticfilmsurface AT wenqiye unidirectionalpropagationofmagnetostaticsurfacespinwavesatamagneticfilmsurface AT chatelonjeanpierre unidirectionalpropagationofmagnetostaticsurfacespinwavesatamagneticfilmsurface AT linyenting unidirectionalpropagationofmagnetostaticsurfacespinwavesatamagneticfilmsurface AT zhanghuaiwu unidirectionalpropagationofmagnetostaticsurfacespinwavesatamagneticfilmsurface AT wangkangl unidirectionalpropagationofmagnetostaticsurfacespinwavesatamagneticfilmsurface AT rosscarolinea unidirectionalpropagationofmagnetostaticsurfacespinwavesatamagneticfilmsurface |