2D full-waveform modeling of seismic waves in layered karstic media
We have developed a new propagator-matrix scheme to simulate seismic-wave propagation and scattering in a multilayered medium containing karstic voids. The propagator matrices can be found using the boundary element method. The model can have irregular boundaries, including arbitrary free-surface to...
| Main Authors: | , , , |
|---|---|
| Other Authors: | |
| Format: | Article |
| Language: | en_US |
| Published: |
Society of Exploration Geophysicists
2017
|
| Online Access: | http://hdl.handle.net/1721.1/108503 https://orcid.org/0000-0002-8814-5495 |
| _version_ | 1826207453979607040 |
|---|---|
| author | Malallah, Adel H. Hu, Hao Zheng, Yingcai Fehler, Michael |
| author2 | Massachusetts Institute of Technology. Department of Earth, Atmospheric, and Planetary Sciences |
| author_facet | Massachusetts Institute of Technology. Department of Earth, Atmospheric, and Planetary Sciences Malallah, Adel H. Hu, Hao Zheng, Yingcai Fehler, Michael |
| author_sort | Malallah, Adel H. |
| collection | MIT |
| description | We have developed a new propagator-matrix scheme to simulate seismic-wave propagation and scattering in a multilayered medium containing karstic voids. The propagator matrices can be found using the boundary element method. The model can have irregular boundaries, including arbitrary free-surface topography. Any number of karsts can be included in the model, and each karst can be of arbitrary geometric shape. We have used the Burton-Miller formulation to tackle the numerical instability caused by the fictitious resonance due to the finite size of a karstic void. Our method was implemented in the frequency-space domain, so frequency-dependent Q can be readily incorporated. We have validated our calculation by comparing it with the analytical solution for a cylindrical void and to the spectral element method for a more complex model. This new modeling capability is useful in many important applications in seismic inverse theory, such as imaging karsts, caves, sinkholes, and clandestine tunnels. |
| first_indexed | 2024-09-23T13:49:54Z |
| format | Article |
| id | mit-1721.1/108503 |
| institution | Massachusetts Institute of Technology |
| language | en_US |
| last_indexed | 2024-09-23T13:49:54Z |
| publishDate | 2017 |
| publisher | Society of Exploration Geophysicists |
| record_format | dspace |
| spelling | mit-1721.1/1085032024-05-15T03:28:25Z 2D full-waveform modeling of seismic waves in layered karstic media Malallah, Adel H. Hu, Hao Zheng, Yingcai Fehler, Michael Massachusetts Institute of Technology. Department of Earth, Atmospheric, and Planetary Sciences Zheng, Yingcai Fehler, Michael C We have developed a new propagator-matrix scheme to simulate seismic-wave propagation and scattering in a multilayered medium containing karstic voids. The propagator matrices can be found using the boundary element method. The model can have irregular boundaries, including arbitrary free-surface topography. Any number of karsts can be included in the model, and each karst can be of arbitrary geometric shape. We have used the Burton-Miller formulation to tackle the numerical instability caused by the fictitious resonance due to the finite size of a karstic void. Our method was implemented in the frequency-space domain, so frequency-dependent Q can be readily incorporated. We have validated our calculation by comparing it with the analytical solution for a cylindrical void and to the spectral element method for a more complex model. This new modeling capability is useful in many important applications in seismic inverse theory, such as imaging karsts, caves, sinkholes, and clandestine tunnels. 2017-04-28T18:32:39Z 2017-04-28T18:32:39Z 2016-03 2015-10 Article http://purl.org/eprint/type/JournalArticle 0016-8033 1942-2156 http://hdl.handle.net/1721.1/108503 Zheng, Yingcai, Adel H. Malallah, Michael C. Fehler, and Hao Hu. “2D Full-Waveform Modeling of Seismic Waves in Layered Karstic Media.” GEOPHYSICS 81, no. 2 (March 2016): T115–T124. © 2016 Society of Exploration Geophysicists https://orcid.org/0000-0002-8814-5495 en_US http://dx.doi.org/10.1190/GEO2015-0307.1 Geophysics Article is made available in accordance with the publisher's policy and may be subject to US copyright law. Please refer to the publisher's site for terms of use. application/pdf Society of Exploration Geophysicists Society of Exploration Geophysicists |
| spellingShingle | Malallah, Adel H. Hu, Hao Zheng, Yingcai Fehler, Michael 2D full-waveform modeling of seismic waves in layered karstic media |
| title | 2D full-waveform modeling of seismic waves in layered karstic media |
| title_full | 2D full-waveform modeling of seismic waves in layered karstic media |
| title_fullStr | 2D full-waveform modeling of seismic waves in layered karstic media |
| title_full_unstemmed | 2D full-waveform modeling of seismic waves in layered karstic media |
| title_short | 2D full-waveform modeling of seismic waves in layered karstic media |
| title_sort | 2d full waveform modeling of seismic waves in layered karstic media |
| url | http://hdl.handle.net/1721.1/108503 https://orcid.org/0000-0002-8814-5495 |
| work_keys_str_mv | AT malallahadelh 2dfullwaveformmodelingofseismicwavesinlayeredkarsticmedia AT huhao 2dfullwaveformmodelingofseismicwavesinlayeredkarsticmedia AT zhengyingcai 2dfullwaveformmodelingofseismicwavesinlayeredkarsticmedia AT fehlermichael 2dfullwaveformmodelingofseismicwavesinlayeredkarsticmedia |