Hyperactivation of sympathetic nerves drives depletion of melanocyte stem cells
Empirical and anecdotal evidence has associated stress with accelerated hair greying (formation of unpigmented hairs)1,2, but so far there has been little scientific validation of this link. Here we report that, in mice, acute stress leads to hair greying through the fast depletion of melanocyte ste...
| Main Authors: | , , , , , , , , , , , , , , , , |
|---|---|
| Other Authors: | |
| Format: | Article |
| Language: | English |
| Published: |
Springer Science and Business Media LLC
2020
|
| Subjects: | |
| Online Access: | https://hdl.handle.net/1721.1/126732 |
| _version_ | 1826209589737029632 |
|---|---|
| author | Zhang, Bing Ma, Sai Rachmin, Inbal He, Megan Baral, Pankaj Choi, Sekyu Gonçalves, William A. Shwartz, Yulia Fast, Eva M. Su, Yiqun Zon, Leonard I. Regev, Aviv Buenrostro, Jason D. Cunha, Thiago M. Chiu, Isaac M. Fisher, David E. Hsu, Ya-Chieh |
| author2 | Massachusetts Institute of Technology. Department of Biology |
| author_facet | Massachusetts Institute of Technology. Department of Biology Zhang, Bing Ma, Sai Rachmin, Inbal He, Megan Baral, Pankaj Choi, Sekyu Gonçalves, William A. Shwartz, Yulia Fast, Eva M. Su, Yiqun Zon, Leonard I. Regev, Aviv Buenrostro, Jason D. Cunha, Thiago M. Chiu, Isaac M. Fisher, David E. Hsu, Ya-Chieh |
| author_sort | Zhang, Bing |
| collection | MIT |
| description | Empirical and anecdotal evidence has associated stress with accelerated hair greying (formation of unpigmented hairs)1,2, but so far there has been little scientific validation of this link. Here we report that, in mice, acute stress leads to hair greying through the fast depletion of melanocyte stem cells. Using a combination of adrenalectomy, denervation, chemogenetics3,4, cell ablation and knockout of the adrenergic receptor specifically in melanocyte stem cells, we find that the stress-induced loss of melanocyte stem cells is independent of immune attack or adrenal stress hormones. Instead, hair greying results from activation of the sympathetic nerves that innervate the melanocyte stem-cell niche. Under conditions of stress, the activation of these sympathetic nerves leads to burst release of the neurotransmitter noradrenaline (also known as norepinephrine). This causes quiescent melanocyte stem cells to proliferate rapidly, and is followed by their differentiation, migration and permanent depletion from the niche. Transient suppression of the proliferation of melanocyte stem cells prevents stress-induced hair greying. Our study demonstrates that neuronal activity that is induced by acute stress can drive a rapid and permanent loss of somatic stem cells, and illustrates an example in which the maintenance of somatic stem cells is directly influenced by the overall physiological state of the organism. |
| first_indexed | 2024-09-23T14:24:52Z |
| format | Article |
| id | mit-1721.1/126732 |
| institution | Massachusetts Institute of Technology |
| language | English |
| last_indexed | 2024-09-23T14:24:52Z |
| publishDate | 2020 |
| publisher | Springer Science and Business Media LLC |
| record_format | dspace |
| spelling | mit-1721.1/1267322022-10-01T21:13:57Z Hyperactivation of sympathetic nerves drives depletion of melanocyte stem cells Hyperactivation of sympathetic nerves drives depletion of melanocyte stem cells Zhang, Bing Ma, Sai Rachmin, Inbal He, Megan Baral, Pankaj Choi, Sekyu Gonçalves, William A. Shwartz, Yulia Fast, Eva M. Su, Yiqun Zon, Leonard I. Regev, Aviv Buenrostro, Jason D. Cunha, Thiago M. Chiu, Isaac M. Fisher, David E. Hsu, Ya-Chieh Massachusetts Institute of Technology. Department of Biology Koch Institute for Integrative Cancer Research at MIT Multidisciplinary Empirical and anecdotal evidence has associated stress with accelerated hair greying (formation of unpigmented hairs)1,2, but so far there has been little scientific validation of this link. Here we report that, in mice, acute stress leads to hair greying through the fast depletion of melanocyte stem cells. Using a combination of adrenalectomy, denervation, chemogenetics3,4, cell ablation and knockout of the adrenergic receptor specifically in melanocyte stem cells, we find that the stress-induced loss of melanocyte stem cells is independent of immune attack or adrenal stress hormones. Instead, hair greying results from activation of the sympathetic nerves that innervate the melanocyte stem-cell niche. Under conditions of stress, the activation of these sympathetic nerves leads to burst release of the neurotransmitter noradrenaline (also known as norepinephrine). This causes quiescent melanocyte stem cells to proliferate rapidly, and is followed by their differentiation, migration and permanent depletion from the niche. Transient suppression of the proliferation of melanocyte stem cells prevents stress-induced hair greying. Our study demonstrates that neuronal activity that is induced by acute stress can drive a rapid and permanent loss of somatic stem cells, and illustrates an example in which the maintenance of somatic stem cells is directly influenced by the overall physiological state of the organism. 2020-08-21T22:39:24Z 2020-08-21T22:39:24Z 2020-01 2019-05 2020-08-20T17:27:07Z Article http://purl.org/eprint/type/JournalArticle 0028-0836 1476-4687 https://hdl.handle.net/1721.1/126732 Zhang, Bing et al. "Hyperactivation of sympathetic nerves drives depletion of melanocyte stem cells." Nature 577, 7792 (January 2020): 676–681 © 2020 The Author(s) en http://dx.doi.org/10.1038/s41586-020-1935-3 Nature Article is made available in accordance with the publisher's policy and may be subject to US copyright law. Please refer to the publisher's site for terms of use. application/pdf Springer Science and Business Media LLC Prof. Regev via Courtney Crummett |
| spellingShingle | Multidisciplinary Zhang, Bing Ma, Sai Rachmin, Inbal He, Megan Baral, Pankaj Choi, Sekyu Gonçalves, William A. Shwartz, Yulia Fast, Eva M. Su, Yiqun Zon, Leonard I. Regev, Aviv Buenrostro, Jason D. Cunha, Thiago M. Chiu, Isaac M. Fisher, David E. Hsu, Ya-Chieh Hyperactivation of sympathetic nerves drives depletion of melanocyte stem cells |
| title | Hyperactivation of sympathetic nerves drives depletion of melanocyte stem cells |
| title_full | Hyperactivation of sympathetic nerves drives depletion of melanocyte stem cells |
| title_fullStr | Hyperactivation of sympathetic nerves drives depletion of melanocyte stem cells |
| title_full_unstemmed | Hyperactivation of sympathetic nerves drives depletion of melanocyte stem cells |
| title_short | Hyperactivation of sympathetic nerves drives depletion of melanocyte stem cells |
| title_sort | hyperactivation of sympathetic nerves drives depletion of melanocyte stem cells |
| topic | Multidisciplinary |
| url | https://hdl.handle.net/1721.1/126732 |
| work_keys_str_mv | AT zhangbing hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT masai hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT rachmininbal hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT hemegan hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT baralpankaj hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT choisekyu hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT goncalveswilliama hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT shwartzyulia hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT fastevam hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT suyiqun hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT zonleonardi hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT regevaviv hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT buenrostrojasond hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT cunhathiagom hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT chiuisaacm hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT fisherdavide hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells AT hsuyachieh hyperactivationofsympatheticnervesdrivesdepletionofmelanocytestemcells |