Time-lapse walkaway vertical seismic profile monitoring for CO[subscript 2] injection at the SACROC enhanced oil recovery field: A case study
Geologic carbon storage involves large-scale injections of carbon dioxide into underground geologic formations. Changes in reservoir properties resulting from CO[subscript 2] injection and migration can be characterized using monitoring methods with time-lapse seismic data. To achieve economical mon...
| Main Authors: | , , , |
|---|---|
| Other Authors: | |
| Format: | Article |
| Language: | en_US |
| Published: |
Society of Exploration Geophysicists
2015
|
| Online Access: | http://hdl.handle.net/1721.1/99689 https://orcid.org/0000-0002-8814-5495 |
| _version_ | 1826196865077477376 |
|---|---|
| author | Yang, Di Fehler, Michael Huang, Lianjie Malcolm, Alison E. |
| author2 | Massachusetts Institute of Technology. Department of Earth, Atmospheric, and Planetary Sciences |
| author_facet | Massachusetts Institute of Technology. Department of Earth, Atmospheric, and Planetary Sciences Yang, Di Fehler, Michael Huang, Lianjie Malcolm, Alison E. |
| author_sort | Yang, Di |
| collection | MIT |
| description | Geologic carbon storage involves large-scale injections of carbon dioxide into underground geologic formations. Changes in reservoir properties resulting from CO[subscript 2] injection and migration can be characterized using monitoring methods with time-lapse seismic data. To achieve economical monitoring, vertical seismic profile (VSP) data are often acquired to survey the local injection area. We investigated the capability of walkaway VSP monitoring for CO[subscript 2] injection into an enhanced oil recovery field at SACROC, West Texas. VSP data sets were acquired in 2008 and 2009, and CO[subscript 2] injection took place after the first data acquisition. Because the receivers were located above the injection zone, only reflection data contain the information from the reservoir. Qualitative comparison between reverse-time migration images at different times revealed vertical shifts of the reflectors’ center, indicating the presence of velocity changes. We examined two methods to quantify the changes in velocity: standard full-waveform inversion (FWI) and image-domain wavefield tomography (IDWT). FWI directly inverts seismic waveforms for velocity models. IDWT inverts for the time-lapse velocity changes by matching the baseline and time-lapse migration images. We found that, for the constrained geometry of VSP surveys, the IDWT result was significantly more consistent with a localized change in velocity as expected from a few months of CO[subscript 2] injection. A synthetic example was used to verify the result from the field data. By contrast, FWI failed to provide quantitative information about the volumetric velocity changes because of the survey geometry and data frequency content. |
| first_indexed | 2024-09-23T10:38:52Z |
| format | Article |
| id | mit-1721.1/99689 |
| institution | Massachusetts Institute of Technology |
| language | en_US |
| last_indexed | 2024-09-23T10:38:52Z |
| publishDate | 2015 |
| publisher | Society of Exploration Geophysicists |
| record_format | dspace |
| spelling | mit-1721.1/996892022-09-30T22:00:43Z Time-lapse walkaway vertical seismic profile monitoring for CO[subscript 2] injection at the SACROC enhanced oil recovery field: A case study Yang, Di Fehler, Michael Huang, Lianjie Malcolm, Alison E. Massachusetts Institute of Technology. Department of Earth, Atmospheric, and Planetary Sciences Massachusetts Institute of Technology. Earth Resources Laboratory Yang, Di Malcolm, Alison E. Fehler, Michael Geologic carbon storage involves large-scale injections of carbon dioxide into underground geologic formations. Changes in reservoir properties resulting from CO[subscript 2] injection and migration can be characterized using monitoring methods with time-lapse seismic data. To achieve economical monitoring, vertical seismic profile (VSP) data are often acquired to survey the local injection area. We investigated the capability of walkaway VSP monitoring for CO[subscript 2] injection into an enhanced oil recovery field at SACROC, West Texas. VSP data sets were acquired in 2008 and 2009, and CO[subscript 2] injection took place after the first data acquisition. Because the receivers were located above the injection zone, only reflection data contain the information from the reservoir. Qualitative comparison between reverse-time migration images at different times revealed vertical shifts of the reflectors’ center, indicating the presence of velocity changes. We examined two methods to quantify the changes in velocity: standard full-waveform inversion (FWI) and image-domain wavefield tomography (IDWT). FWI directly inverts seismic waveforms for velocity models. IDWT inverts for the time-lapse velocity changes by matching the baseline and time-lapse migration images. We found that, for the constrained geometry of VSP surveys, the IDWT result was significantly more consistent with a localized change in velocity as expected from a few months of CO[subscript 2] injection. A synthetic example was used to verify the result from the field data. By contrast, FWI failed to provide quantitative information about the volumetric velocity changes because of the survey geometry and data frequency content. 2015-11-03T18:31:39Z 2015-11-03T18:31:39Z 2014-02 2013-07 Article http://purl.org/eprint/type/JournalArticle 0016-8033 1942-2156 http://hdl.handle.net/1721.1/99689 Yang, Di, Alison Malcolm, Michael Fehler, and Lianjie Huang. “Time-Lapse Walkaway Vertical Seismic Profile Monitoring for CO[subscript 2] Injection at the SACROC Enhanced Oil Recovery Field: A Case Study.” GEOPHYSICS 79, no. 2 (March 2014): B51–B61. © 2014 Society of Exploration Geophysicists https://orcid.org/0000-0002-8814-5495 en_US http://dx.doi.org/10.1190/GEO2013-0274.1 Geophysics Article is made available in accordance with the publisher's policy and may be subject to US copyright law. Please refer to the publisher's site for terms of use. application/pdf Society of Exploration Geophysicists Society of Exploration Geophysicists |
| spellingShingle | Yang, Di Fehler, Michael Huang, Lianjie Malcolm, Alison E. Time-lapse walkaway vertical seismic profile monitoring for CO[subscript 2] injection at the SACROC enhanced oil recovery field: A case study |
| title | Time-lapse walkaway vertical seismic profile monitoring for CO[subscript 2] injection at the SACROC enhanced oil recovery field: A case study |
| title_full | Time-lapse walkaway vertical seismic profile monitoring for CO[subscript 2] injection at the SACROC enhanced oil recovery field: A case study |
| title_fullStr | Time-lapse walkaway vertical seismic profile monitoring for CO[subscript 2] injection at the SACROC enhanced oil recovery field: A case study |
| title_full_unstemmed | Time-lapse walkaway vertical seismic profile monitoring for CO[subscript 2] injection at the SACROC enhanced oil recovery field: A case study |
| title_short | Time-lapse walkaway vertical seismic profile monitoring for CO[subscript 2] injection at the SACROC enhanced oil recovery field: A case study |
| title_sort | time lapse walkaway vertical seismic profile monitoring for co subscript 2 injection at the sacroc enhanced oil recovery field a case study |
| url | http://hdl.handle.net/1721.1/99689 https://orcid.org/0000-0002-8814-5495 |
| work_keys_str_mv | AT yangdi timelapsewalkawayverticalseismicprofilemonitoringforcosubscript2injectionatthesacrocenhancedoilrecoveryfieldacasestudy AT fehlermichael timelapsewalkawayverticalseismicprofilemonitoringforcosubscript2injectionatthesacrocenhancedoilrecoveryfieldacasestudy AT huanglianjie timelapsewalkawayverticalseismicprofilemonitoringforcosubscript2injectionatthesacrocenhancedoilrecoveryfieldacasestudy AT malcolmalisone timelapsewalkawayverticalseismicprofilemonitoringforcosubscript2injectionatthesacrocenhancedoilrecoveryfieldacasestudy |