Oleic acid-assisted exfoliated few layer graphene films as counter electrode in dye-sensitized solar cell
We have demonstrated a facile sonication method to exfoliate graphite into few layer graphene with a high concentration of 1.3 mg/mL in oleic acid (OLA). The exfoliations of natural graphite in oleylamine (OA) and trioctylphosphine (TOP) are investigated as a comparison. The few layer graphene dispe...
| Main Authors: | , , |
|---|---|
| Other Authors: | |
| Format: | Journal Article |
| Language: | English |
| Published: |
2013
|
| Online Access: | https://hdl.handle.net/10356/100737 http://hdl.handle.net/10220/11650 |
| _version_ | 1811691659218386944 |
|---|---|
| author | Liu, Jincheng Wang, Yinjie Sun, Darren Delai |
| author2 | School of Civil and Environmental Engineering |
| author_facet | School of Civil and Environmental Engineering Liu, Jincheng Wang, Yinjie Sun, Darren Delai |
| author_sort | Liu, Jincheng |
| collection | NTU |
| description | We have demonstrated a facile sonication method to exfoliate graphite into few layer graphene with a high concentration of 1.3 mg/mL in oleic acid (OLA). The exfoliations of natural graphite in oleylamine (OA) and trioctylphosphine (TOP) are investigated as a comparison. The few layer graphene dispersion in OLA and the graphite nanoparticles in OA are confirmed by transmission electron microscopy (TEM) observation. The exfoliated graphene dispersion in OLA (OLA-G) and graphite dispersion in OA (OA-G) are fabricated into a film on the FTO substrate by the doctor-blading method. The morphology and catalytic activity in the redox couple regeneration of all the graphite films are examined by field emission scanning electron microscopy and cyclic voltammograms. The OLA-G films on FTO glass with few layer graphene flakes shows better catalytic activity than the OA-G films. The energy conversion efficiency of the cell with the OLA-G film as counter electrode reached 3.56%, which is 70% of dye-sensitized solar cell (DSSC) with the sputtering-Pt counter electrode under the same experimental condition. |
| first_indexed | 2024-10-01T06:23:24Z |
| format | Journal Article |
| id | ntu-10356/100737 |
| institution | Nanyang Technological University |
| language | English |
| last_indexed | 2024-10-01T06:23:24Z |
| publishDate | 2013 |
| record_format | dspace |
| spelling | ntu-10356/1007372020-03-07T11:43:46Z Oleic acid-assisted exfoliated few layer graphene films as counter electrode in dye-sensitized solar cell Liu, Jincheng Wang, Yinjie Sun, Darren Delai School of Civil and Environmental Engineering We have demonstrated a facile sonication method to exfoliate graphite into few layer graphene with a high concentration of 1.3 mg/mL in oleic acid (OLA). The exfoliations of natural graphite in oleylamine (OA) and trioctylphosphine (TOP) are investigated as a comparison. The few layer graphene dispersion in OLA and the graphite nanoparticles in OA are confirmed by transmission electron microscopy (TEM) observation. The exfoliated graphene dispersion in OLA (OLA-G) and graphite dispersion in OA (OA-G) are fabricated into a film on the FTO substrate by the doctor-blading method. The morphology and catalytic activity in the redox couple regeneration of all the graphite films are examined by field emission scanning electron microscopy and cyclic voltammograms. The OLA-G films on FTO glass with few layer graphene flakes shows better catalytic activity than the OA-G films. The energy conversion efficiency of the cell with the OLA-G film as counter electrode reached 3.56%, which is 70% of dye-sensitized solar cell (DSSC) with the sputtering-Pt counter electrode under the same experimental condition. 2013-07-17T02:44:18Z 2019-12-06T20:27:24Z 2013-07-17T02:44:18Z 2019-12-06T20:27:24Z 2012 2012 Journal Article Liu, J., Wang, Y., & Sun, D. D. (2012). Oleic acid-assisted exfoliated few layer graphene films as counter electrode in dye-sensitized solar cell. Journal of Alloys and Compounds, 545, 99-104. 0925-8388 https://hdl.handle.net/10356/100737 http://hdl.handle.net/10220/11650 10.1016/j.jallcom.2012.08.050 en Journal of alloys and compounds © 2012 Elsevier B.V. |
| spellingShingle | Liu, Jincheng Wang, Yinjie Sun, Darren Delai Oleic acid-assisted exfoliated few layer graphene films as counter electrode in dye-sensitized solar cell |
| title | Oleic acid-assisted exfoliated few layer graphene films as counter electrode in dye-sensitized solar cell |
| title_full | Oleic acid-assisted exfoliated few layer graphene films as counter electrode in dye-sensitized solar cell |
| title_fullStr | Oleic acid-assisted exfoliated few layer graphene films as counter electrode in dye-sensitized solar cell |
| title_full_unstemmed | Oleic acid-assisted exfoliated few layer graphene films as counter electrode in dye-sensitized solar cell |
| title_short | Oleic acid-assisted exfoliated few layer graphene films as counter electrode in dye-sensitized solar cell |
| title_sort | oleic acid assisted exfoliated few layer graphene films as counter electrode in dye sensitized solar cell |
| url | https://hdl.handle.net/10356/100737 http://hdl.handle.net/10220/11650 |
| work_keys_str_mv | AT liujincheng oleicacidassistedexfoliatedfewlayergraphenefilmsascounterelectrodeindyesensitizedsolarcell AT wangyinjie oleicacidassistedexfoliatedfewlayergraphenefilmsascounterelectrodeindyesensitizedsolarcell AT sundarrendelai oleicacidassistedexfoliatedfewlayergraphenefilmsascounterelectrodeindyesensitizedsolarcell |