Extremely versatile deformability beyond materiality : a new material platform through simple cutting for rugged batteries
A rugged lithium-ion battery (LIB) can be realized without any new material development through selective material matching based on localized deformation of a substrate induced by its well-designed pattern. In particular, an auxetic cut flexible substrate accommodates various complex deformations a...
| Main Authors: | , , , , , , , , , |
|---|---|
| Other Authors: | |
| Format: | Journal Article |
| Language: | English |
| Published: |
2021
|
| Subjects: | |
| Online Access: | https://hdl.handle.net/10356/150564 |
| _version_ | 1824454026470621184 |
|---|---|
| author | Kim, Kee-Bum Lee, Young-Joo Costa, Avelino Lee, Yu-Ki Jang, Tae-Sik Lee, Myoung-Gyu Joo, Young-Chang Oh, Kyu Hwan Song, Juha Choi, In-Suk |
| author2 | School of Chemical and Biomedical Engineering |
| author_facet | School of Chemical and Biomedical Engineering Kim, Kee-Bum Lee, Young-Joo Costa, Avelino Lee, Yu-Ki Jang, Tae-Sik Lee, Myoung-Gyu Joo, Young-Chang Oh, Kyu Hwan Song, Juha Choi, In-Suk |
| author_sort | Kim, Kee-Bum |
| collection | NTU |
| description | A rugged lithium-ion battery (LIB) can be realized without any new material development through selective material matching based on localized deformation of a substrate induced by its well-designed pattern. In particular, an auxetic cut flexible substrate accommodates various complex deformations and adaptive conformations through the hinge joints because the external force is highly localized in the hinges while the segmented motifs remain almost undeformed. The embedded LIB cells in undeformed regions of the auxetic cut silicon rubber sheet do not undergo large deformation, maintaining their battery performance regardless of loading conditions via the pattern-associated deformation mechanism. The hierarchy and number of segmentations are the key parameters of the deformation mechanism for auxetic cut shape-reconfigurable battery systems. The numerically and experimentally proven strategy that utilizes strain gradients induced by a patterned substrate as a design guideline for material matching can lead to various wearable and conformable designs without sacrificing the functionality and durability of electronic devices. |
| first_indexed | 2025-02-19T03:15:46Z |
| format | Journal Article |
| id | ntu-10356/150564 |
| institution | Nanyang Technological University |
| language | English |
| last_indexed | 2025-02-19T03:15:46Z |
| publishDate | 2021 |
| record_format | dspace |
| spelling | ntu-10356/1505642021-06-14T08:23:12Z Extremely versatile deformability beyond materiality : a new material platform through simple cutting for rugged batteries Kim, Kee-Bum Lee, Young-Joo Costa, Avelino Lee, Yu-Ki Jang, Tae-Sik Lee, Myoung-Gyu Joo, Young-Chang Oh, Kyu Hwan Song, Juha Choi, In-Suk School of Chemical and Biomedical Engineering Engineering::Chemical engineering Architected Materials Hierarchical Cuts A rugged lithium-ion battery (LIB) can be realized without any new material development through selective material matching based on localized deformation of a substrate induced by its well-designed pattern. In particular, an auxetic cut flexible substrate accommodates various complex deformations and adaptive conformations through the hinge joints because the external force is highly localized in the hinges while the segmented motifs remain almost undeformed. The embedded LIB cells in undeformed regions of the auxetic cut silicon rubber sheet do not undergo large deformation, maintaining their battery performance regardless of loading conditions via the pattern-associated deformation mechanism. The hierarchy and number of segmentations are the key parameters of the deformation mechanism for auxetic cut shape-reconfigurable battery systems. The numerically and experimentally proven strategy that utilizes strain gradients induced by a patterned substrate as a design guideline for material matching can lead to various wearable and conformable designs without sacrificing the functionality and durability of electronic devices. Ministry of Education (MOE) This work was supported by the National Research Foundation of Korea (NRF) (2015R1A2A2A04006933). I.-S. Choi is partially supported by the innovative research grant from Seoul National University and Y.-C. Joo acknowledged financial support through the Korean Government (MSIP) (NRF-2016R1A5A1938472). J. Song also acknowledged financial support through the AcRF Tier 1 grant 2017-T1-001-246 (RG51/17) from Ministry of Education of Singapore. 2021-06-14T08:23:12Z 2021-06-14T08:23:12Z 2019 Journal Article Kim, K., Lee, Y., Costa, A., Lee, Y., Jang, T., Lee, M., Joo, Y., Oh, K. H., Song, J. & Choi, I. (2019). Extremely versatile deformability beyond materiality : a new material platform through simple cutting for rugged batteries. Advanced Engineering Materials, 21(7), 1900206-. https://dx.doi.org/10.1002/adem.201900206 1438-1656 0000-0002-3503-680X https://hdl.handle.net/10356/150564 10.1002/adem.201900206 2-s2.0-85062966031 7 21 1900206 en 2017-T1-001-246 (RG51/17) Advanced Engineering Materials © 2019 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim. All rights reserved. |
| spellingShingle | Engineering::Chemical engineering Architected Materials Hierarchical Cuts Kim, Kee-Bum Lee, Young-Joo Costa, Avelino Lee, Yu-Ki Jang, Tae-Sik Lee, Myoung-Gyu Joo, Young-Chang Oh, Kyu Hwan Song, Juha Choi, In-Suk Extremely versatile deformability beyond materiality : a new material platform through simple cutting for rugged batteries |
| title | Extremely versatile deformability beyond materiality : a new material platform through simple cutting for rugged batteries |
| title_full | Extremely versatile deformability beyond materiality : a new material platform through simple cutting for rugged batteries |
| title_fullStr | Extremely versatile deformability beyond materiality : a new material platform through simple cutting for rugged batteries |
| title_full_unstemmed | Extremely versatile deformability beyond materiality : a new material platform through simple cutting for rugged batteries |
| title_short | Extremely versatile deformability beyond materiality : a new material platform through simple cutting for rugged batteries |
| title_sort | extremely versatile deformability beyond materiality a new material platform through simple cutting for rugged batteries |
| topic | Engineering::Chemical engineering Architected Materials Hierarchical Cuts |
| url | https://hdl.handle.net/10356/150564 |
| work_keys_str_mv | AT kimkeebum extremelyversatiledeformabilitybeyondmaterialityanewmaterialplatformthroughsimplecuttingforruggedbatteries AT leeyoungjoo extremelyversatiledeformabilitybeyondmaterialityanewmaterialplatformthroughsimplecuttingforruggedbatteries AT costaavelino extremelyversatiledeformabilitybeyondmaterialityanewmaterialplatformthroughsimplecuttingforruggedbatteries AT leeyuki extremelyversatiledeformabilitybeyondmaterialityanewmaterialplatformthroughsimplecuttingforruggedbatteries AT jangtaesik extremelyversatiledeformabilitybeyondmaterialityanewmaterialplatformthroughsimplecuttingforruggedbatteries AT leemyounggyu extremelyversatiledeformabilitybeyondmaterialityanewmaterialplatformthroughsimplecuttingforruggedbatteries AT jooyoungchang extremelyversatiledeformabilitybeyondmaterialityanewmaterialplatformthroughsimplecuttingforruggedbatteries AT ohkyuhwan extremelyversatiledeformabilitybeyondmaterialityanewmaterialplatformthroughsimplecuttingforruggedbatteries AT songjuha extremelyversatiledeformabilitybeyondmaterialityanewmaterialplatformthroughsimplecuttingforruggedbatteries AT choiinsuk extremelyversatiledeformabilitybeyondmaterialityanewmaterialplatformthroughsimplecuttingforruggedbatteries |