FORMULAIC ANALYSIS OF SARA PARETSKY'S AND S. MARA GD'S DETECTIVE NOVELS:A COMPARATIVE STUDY 9(Analisa Formula pada Novel Detektif Sara Paretsky dan S.Mara GD: Studi Komparatif) .

This thesis is a study of Sara Paretsky's and Mara Gd's popular novels in relation to the influence of economic and sociocultural factors which un¬derlie the creation of Sara Paretsky's and Mara Gd's detective novels. The works of popular literature are chosen here because this...

Full description

Bibliographic Details
Main Author: Perpustakaan UGM, i-lib
Format: Article
Published: [Yogyakarta] : Universitas Gadjah Mada 2004
Subjects:
_version_ 1826031196076769280
author Perpustakaan UGM, i-lib
author_facet Perpustakaan UGM, i-lib
author_sort Perpustakaan UGM, i-lib
collection UGM
description This thesis is a study of Sara Paretsky's and Mara Gd's popular novels in relation to the influence of economic and sociocultural factors which un¬derlie the creation of Sara Paretsky's and Mara Gd's detective novels. The works of popular literature are chosen here because this thesis is also in¬tended to argue that practically the works of popular culture are also inter¬esting and even important to be analyzed. This study covers, firstly, the discussion about detective novels as one of the popular culture's products which have a big number of readers, and secondly an analysis of the influence of economic and sociocultural condi¬tions on the creation of both these American and Indonesian detective nov¬els. Applying an interdisciplinary approach, and assuming that Sara Paretsky's and Mara Gd's detective novels are the mental evidence in seeing the motif, variation, and the rate of crime in both Indonesia and America, this study particularly describes the difference in the obstacles and challenges which should be faced by the detectives. For this purpose, four novels of each are observed. The result is then compared to the realities of economic and sociocultural conditions in America and Indonesia during the times these popular detective novels were written. The result of the observation shows that in the case of crime rate, America suffers higher crime rate than Indonesia because one of the factors is the advancement in using industrial technology. Keywords: Economic condition � sociocultural condition - the influence � crime � detective.
first_indexed 2024-03-05T22:52:58Z
format Article
id oai:generic.eprints.org:17996
institution Universiti Gadjah Mada
last_indexed 2024-03-05T22:52:58Z
publishDate 2004
publisher [Yogyakarta] : Universitas Gadjah Mada
record_format dspace
spelling oai:generic.eprints.org:179962014-06-18T00:28:05Z https://repository.ugm.ac.id/17996/ FORMULAIC ANALYSIS OF SARA PARETSKY'S AND S. MARA GD'S DETECTIVE NOVELS:A COMPARATIVE STUDY 9(Analisa Formula pada Novel Detektif Sara Paretsky dan S.Mara GD: Studi Komparatif) . Perpustakaan UGM, i-lib Jurnal i-lib UGM This thesis is a study of Sara Paretsky's and Mara Gd's popular novels in relation to the influence of economic and sociocultural factors which un¬derlie the creation of Sara Paretsky's and Mara Gd's detective novels. The works of popular literature are chosen here because this thesis is also in¬tended to argue that practically the works of popular culture are also inter¬esting and even important to be analyzed. This study covers, firstly, the discussion about detective novels as one of the popular culture's products which have a big number of readers, and secondly an analysis of the influence of economic and sociocultural condi¬tions on the creation of both these American and Indonesian detective nov¬els. Applying an interdisciplinary approach, and assuming that Sara Paretsky's and Mara Gd's detective novels are the mental evidence in seeing the motif, variation, and the rate of crime in both Indonesia and America, this study particularly describes the difference in the obstacles and challenges which should be faced by the detectives. For this purpose, four novels of each are observed. The result is then compared to the realities of economic and sociocultural conditions in America and Indonesia during the times these popular detective novels were written. The result of the observation shows that in the case of crime rate, America suffers higher crime rate than Indonesia because one of the factors is the advancement in using industrial technology. Keywords: Economic condition � sociocultural condition - the influence � crime � detective. [Yogyakarta] : Universitas Gadjah Mada 2004 Article NonPeerReviewed Perpustakaan UGM, i-lib (2004) FORMULAIC ANALYSIS OF SARA PARETSKY'S AND S. MARA GD'S DETECTIVE NOVELS:A COMPARATIVE STUDY 9(Analisa Formula pada Novel Detektif Sara Paretsky dan S.Mara GD: Studi Komparatif) . Jurnal i-lib UGM. http://i-lib.ugm.ac.id/jurnal/download.php?dataId=771
spellingShingle Jurnal i-lib UGM
Perpustakaan UGM, i-lib
FORMULAIC ANALYSIS OF SARA PARETSKY'S AND S. MARA GD'S DETECTIVE NOVELS:A COMPARATIVE STUDY 9(Analisa Formula pada Novel Detektif Sara Paretsky dan S.Mara GD: Studi Komparatif) .
title FORMULAIC ANALYSIS OF SARA PARETSKY'S AND S. MARA GD'S DETECTIVE NOVELS:A COMPARATIVE STUDY 9(Analisa Formula pada Novel Detektif Sara Paretsky dan S.Mara GD: Studi Komparatif) .
title_full FORMULAIC ANALYSIS OF SARA PARETSKY'S AND S. MARA GD'S DETECTIVE NOVELS:A COMPARATIVE STUDY 9(Analisa Formula pada Novel Detektif Sara Paretsky dan S.Mara GD: Studi Komparatif) .
title_fullStr FORMULAIC ANALYSIS OF SARA PARETSKY'S AND S. MARA GD'S DETECTIVE NOVELS:A COMPARATIVE STUDY 9(Analisa Formula pada Novel Detektif Sara Paretsky dan S.Mara GD: Studi Komparatif) .
title_full_unstemmed FORMULAIC ANALYSIS OF SARA PARETSKY'S AND S. MARA GD'S DETECTIVE NOVELS:A COMPARATIVE STUDY 9(Analisa Formula pada Novel Detektif Sara Paretsky dan S.Mara GD: Studi Komparatif) .
title_short FORMULAIC ANALYSIS OF SARA PARETSKY'S AND S. MARA GD'S DETECTIVE NOVELS:A COMPARATIVE STUDY 9(Analisa Formula pada Novel Detektif Sara Paretsky dan S.Mara GD: Studi Komparatif) .
title_sort formulaic analysis of sara paretsky s and s mara gd s detective novels a comparative study 9 analisa formula pada novel detektif sara paretsky dan s mara gd studi komparatif
topic Jurnal i-lib UGM
work_keys_str_mv AT perpustakaanugmilib formulaicanalysisofsaraparetskysandsmaragdsdetectivenovelsacomparativestudy9analisaformulapadanoveldetektifsaraparetskydansmaragdstudikomparatif