Fraksinasi dan identifikasi senyawa volatil asap cair cangkang sawit=(fractionations and identification of volatile compounds of liquid smoke
ABSTRACT Palm kernel shell is one residue material of oil palm process industry. Total palm kernel shell were sufficient and could be processed into liquid smoke. The liquid smoke has been found to contain compounds functioning as smoky product improvement. This research was to identify volatile com...
| Main Author: | |
|---|---|
| Format: | Article |
| Published: |
[Yogyakarta] : Universitas Gadjah Mada
2005
|
| Subjects: |
| _version_ | 1826032026593001472 |
|---|---|
| author | Perpustakaan UGM, i-lib |
| author_facet | Perpustakaan UGM, i-lib |
| author_sort | Perpustakaan UGM, i-lib |
| collection | UGM |
| description | ABSTRACT
Palm kernel shell is one residue material of oil palm process industry. Total palm kernel shell were sufficient and could be processed into liquid smoke. The liquid smoke has been found to contain compounds functioning as smoky product improvement. This research was to identify volatile compound components existing in the liquid smoke of pabn kernel shell.
This research started from liquid smoke production by pirolisa at 400 °C for 90 minutes and fractionation of temperature variation |
| first_indexed | 2024-03-13T18:47:00Z |
| format | Article |
| id | oai:generic.eprints.org:22258 |
| institution | Universiti Gadjah Mada |
| last_indexed | 2024-03-13T18:47:00Z |
| publishDate | 2005 |
| publisher | [Yogyakarta] : Universitas Gadjah Mada |
| record_format | dspace |
| spelling | oai:generic.eprints.org:222582014-06-18T00:26:40Z https://repository.ugm.ac.id/22258/ Fraksinasi dan identifikasi senyawa volatil asap cair cangkang sawit=(fractionations and identification of volatile compounds of liquid smoke Perpustakaan UGM, i-lib Jurnal i-lib UGM ABSTRACT Palm kernel shell is one residue material of oil palm process industry. Total palm kernel shell were sufficient and could be processed into liquid smoke. The liquid smoke has been found to contain compounds functioning as smoky product improvement. This research was to identify volatile compound components existing in the liquid smoke of pabn kernel shell. This research started from liquid smoke production by pirolisa at 400 °C for 90 minutes and fractionation of temperature variation [Yogyakarta] : Universitas Gadjah Mada 2005 Article NonPeerReviewed Perpustakaan UGM, i-lib (2005) Fraksinasi dan identifikasi senyawa volatil asap cair cangkang sawit=(fractionations and identification of volatile compounds of liquid smoke. Jurnal i-lib UGM. http://i-lib.ugm.ac.id/jurnal/download.php?dataId=5144 |
| spellingShingle | Jurnal i-lib UGM Perpustakaan UGM, i-lib Fraksinasi dan identifikasi senyawa volatil asap cair cangkang sawit=(fractionations and identification of volatile compounds of liquid smoke |
| title | Fraksinasi dan identifikasi senyawa volatil asap cair cangkang sawit=(fractionations and identification of volatile compounds of liquid smoke |
| title_full | Fraksinasi dan identifikasi senyawa volatil asap cair cangkang sawit=(fractionations and identification of volatile compounds of liquid smoke |
| title_fullStr | Fraksinasi dan identifikasi senyawa volatil asap cair cangkang sawit=(fractionations and identification of volatile compounds of liquid smoke |
| title_full_unstemmed | Fraksinasi dan identifikasi senyawa volatil asap cair cangkang sawit=(fractionations and identification of volatile compounds of liquid smoke |
| title_short | Fraksinasi dan identifikasi senyawa volatil asap cair cangkang sawit=(fractionations and identification of volatile compounds of liquid smoke |
| title_sort | fraksinasi dan identifikasi senyawa volatil asap cair cangkang sawit fractionations and identification of volatile compounds of liquid smoke |
| topic | Jurnal i-lib UGM |
| work_keys_str_mv | AT perpustakaanugmilib fraksinasidanidentifikasisenyawavolatilasapcaircangkangsawitfractionationsandidentificationofvolatilecompoundsofliquidsmoke |