Evidence of magnetic field decay in massive main-sequence stars
A significant fraction of massive main-sequence stars show strong, large-scale magnetic fields. The origin of these fields, their lifetimes, and their role in shaping the characteristics and evolution of massive stars are currently not well understood. We compile a catalogue of 389 massive main-sequ...
| Main Authors: | , , , , , , , , , , |
|---|---|
| Format: | Journal article |
| Language: | English |
| Published: |
EDP Sciences
2016
|
| _version_ | 1797064980510539776 |
|---|---|
| author | Fossati, L Schneider, F Castro, N Langer, N Simón-Díaz, S Müller, A de Koter, A Morel, T Petit, V Sana, H Wade, G |
| author_facet | Fossati, L Schneider, F Castro, N Langer, N Simón-Díaz, S Müller, A de Koter, A Morel, T Petit, V Sana, H Wade, G |
| author_sort | Fossati, L |
| collection | OXFORD |
| description | A significant fraction of massive main-sequence stars show strong, large-scale magnetic fields. The origin of these fields, their lifetimes, and their role in shaping the characteristics and evolution of massive stars are currently not well understood. We compile a catalogue of 389 massive main-sequence stars, 61 of which are magnetic, and derive their fundamental parameters and ages. The two samples contain stars brighter than magnitude 9 in the V-band and range in mass between 5 and 100 M⊙. We find that the fractional main-sequence age distribution of all considered stars follows what is expected for a magnitude limited sample, while that of magnetic stars shows a clear decrease towards the end of the main sequence. This dearth of old magnetic stars is independent of the choice of adopted stellar evolution tracks, and appears to become more prominent when considering only the most massive stars. We show that the decreasing trend in the distribution is significantly stronger than expected from magnetic flux conservation. We also find that binary rejuvenation and magnetic suppression of core convection are unlikely to be responsible for the observed lack of older magnetic massive stars, and conclude that its most probable cause is the decay of the magnetic field, over a time span longer than the stellar lifetime for the lowest considered masses, and shorter for the highest masses. We then investigate the spin-down ages of the slowly rotating magnetic massive stars and find them to exceed the stellar ages by far in many cases. The high fraction of very slowly rotating magnetic stars thus provides an independent argument for a decay of the magnetic fields. |
| first_indexed | 2024-03-06T21:22:04Z |
| format | Journal article |
| id | oxford-uuid:41c822ea-6c20-4e2d-b7cd-d5d38a9d92f5 |
| institution | University of Oxford |
| language | English |
| last_indexed | 2024-03-06T21:22:04Z |
| publishDate | 2016 |
| publisher | EDP Sciences |
| record_format | dspace |
| spelling | oxford-uuid:41c822ea-6c20-4e2d-b7cd-d5d38a9d92f52022-03-26T14:45:46ZEvidence of magnetic field decay in massive main-sequence starsJournal articlehttp://purl.org/coar/resource_type/c_dcae04bcuuid:41c822ea-6c20-4e2d-b7cd-d5d38a9d92f5EnglishSymplectic Elements at OxfordEDP Sciences2016Fossati, LSchneider, FCastro, NLanger, NSimón-Díaz, SMüller, Ade Koter, AMorel, TPetit, VSana, HWade, GA significant fraction of massive main-sequence stars show strong, large-scale magnetic fields. The origin of these fields, their lifetimes, and their role in shaping the characteristics and evolution of massive stars are currently not well understood. We compile a catalogue of 389 massive main-sequence stars, 61 of which are magnetic, and derive their fundamental parameters and ages. The two samples contain stars brighter than magnitude 9 in the V-band and range in mass between 5 and 100 M⊙. We find that the fractional main-sequence age distribution of all considered stars follows what is expected for a magnitude limited sample, while that of magnetic stars shows a clear decrease towards the end of the main sequence. This dearth of old magnetic stars is independent of the choice of adopted stellar evolution tracks, and appears to become more prominent when considering only the most massive stars. We show that the decreasing trend in the distribution is significantly stronger than expected from magnetic flux conservation. We also find that binary rejuvenation and magnetic suppression of core convection are unlikely to be responsible for the observed lack of older magnetic massive stars, and conclude that its most probable cause is the decay of the magnetic field, over a time span longer than the stellar lifetime for the lowest considered masses, and shorter for the highest masses. We then investigate the spin-down ages of the slowly rotating magnetic massive stars and find them to exceed the stellar ages by far in many cases. The high fraction of very slowly rotating magnetic stars thus provides an independent argument for a decay of the magnetic fields. |
| spellingShingle | Fossati, L Schneider, F Castro, N Langer, N Simón-Díaz, S Müller, A de Koter, A Morel, T Petit, V Sana, H Wade, G Evidence of magnetic field decay in massive main-sequence stars |
| title | Evidence of magnetic field decay in massive main-sequence stars |
| title_full | Evidence of magnetic field decay in massive main-sequence stars |
| title_fullStr | Evidence of magnetic field decay in massive main-sequence stars |
| title_full_unstemmed | Evidence of magnetic field decay in massive main-sequence stars |
| title_short | Evidence of magnetic field decay in massive main-sequence stars |
| title_sort | evidence of magnetic field decay in massive main sequence stars |
| work_keys_str_mv | AT fossatil evidenceofmagneticfielddecayinmassivemainsequencestars AT schneiderf evidenceofmagneticfielddecayinmassivemainsequencestars AT castron evidenceofmagneticfielddecayinmassivemainsequencestars AT langern evidenceofmagneticfielddecayinmassivemainsequencestars AT simondiazs evidenceofmagneticfielddecayinmassivemainsequencestars AT mullera evidenceofmagneticfielddecayinmassivemainsequencestars AT dekotera evidenceofmagneticfielddecayinmassivemainsequencestars AT morelt evidenceofmagneticfielddecayinmassivemainsequencestars AT petitv evidenceofmagneticfielddecayinmassivemainsequencestars AT sanah evidenceofmagneticfielddecayinmassivemainsequencestars AT wadeg evidenceofmagneticfielddecayinmassivemainsequencestars |