MIGRAs: are they the new IGRAs? Development of monokine-amplified IFN-γ release assays.
IFN-γ release by antigen-specific T cells can be used to track immune responses to infections and vaccines. In recent years, there have been substantial advances in the techniques available to measure IFN-γ release and a generation of such assays are now available for clinical use, as well as in a r...
| Main Authors: | , , , |
|---|---|
| Format: | Journal article |
| Language: | English |
| Published: |
2012
|
| _version_ | 1826274110448074752 |
|---|---|
| author | Kasprowicz, V Halliday, J Mitchell, J Klenerman, P |
| author_facet | Kasprowicz, V Halliday, J Mitchell, J Klenerman, P |
| author_sort | Kasprowicz, V |
| collection | OXFORD |
| description | IFN-γ release by antigen-specific T cells can be used to track immune responses to infections and vaccines. In recent years, there have been substantial advances in the techniques available to measure IFN-γ release and a generation of such assays are now available for clinical use, as well as in a research setting. Interferon release leads to subsequent release of interferon-responsive chemokines such as MIG and IP-10, thus amplifying the original signal. A number of investigators have assessed whether measurement of these chemokines might provide a sensitive platform for detection of infection and antigen-specific T-cell responses. In this article, we assess the potential of these new approaches. We have termed the new antigen-specific T-cell assays monokine-amplified IFN-γ release assays (MIGRAs). Overall, it seems likely that improvements in the detection threshold could be made by analysis of antigen-triggered chemokines and potentially of other molecules in the future, although whether MIGRAs will provide additional clinical utility still remains to be determined. |
| first_indexed | 2024-03-06T22:38:28Z |
| format | Journal article |
| id | oxford-uuid:5ab994a1-1290-4706-8109-a307a7d022aa |
| institution | University of Oxford |
| language | English |
| last_indexed | 2024-03-06T22:38:28Z |
| publishDate | 2012 |
| record_format | dspace |
| spelling | oxford-uuid:5ab994a1-1290-4706-8109-a307a7d022aa2022-03-26T17:17:33ZMIGRAs: are they the new IGRAs? Development of monokine-amplified IFN-γ release assays.Journal articlehttp://purl.org/coar/resource_type/c_dcae04bcuuid:5ab994a1-1290-4706-8109-a307a7d022aaEnglishSymplectic Elements at Oxford2012Kasprowicz, VHalliday, JMitchell, JKlenerman, PIFN-γ release by antigen-specific T cells can be used to track immune responses to infections and vaccines. In recent years, there have been substantial advances in the techniques available to measure IFN-γ release and a generation of such assays are now available for clinical use, as well as in a research setting. Interferon release leads to subsequent release of interferon-responsive chemokines such as MIG and IP-10, thus amplifying the original signal. A number of investigators have assessed whether measurement of these chemokines might provide a sensitive platform for detection of infection and antigen-specific T-cell responses. In this article, we assess the potential of these new approaches. We have termed the new antigen-specific T-cell assays monokine-amplified IFN-γ release assays (MIGRAs). Overall, it seems likely that improvements in the detection threshold could be made by analysis of antigen-triggered chemokines and potentially of other molecules in the future, although whether MIGRAs will provide additional clinical utility still remains to be determined. |
| spellingShingle | Kasprowicz, V Halliday, J Mitchell, J Klenerman, P MIGRAs: are they the new IGRAs? Development of monokine-amplified IFN-γ release assays. |
| title | MIGRAs: are they the new IGRAs? Development of monokine-amplified IFN-γ release assays. |
| title_full | MIGRAs: are they the new IGRAs? Development of monokine-amplified IFN-γ release assays. |
| title_fullStr | MIGRAs: are they the new IGRAs? Development of monokine-amplified IFN-γ release assays. |
| title_full_unstemmed | MIGRAs: are they the new IGRAs? Development of monokine-amplified IFN-γ release assays. |
| title_short | MIGRAs: are they the new IGRAs? Development of monokine-amplified IFN-γ release assays. |
| title_sort | migras are they the new igras development of monokine amplified ifn γ release assays |
| work_keys_str_mv | AT kasprowiczv migrasaretheythenewigrasdevelopmentofmonokineamplifiedifngreleaseassays AT hallidayj migrasaretheythenewigrasdevelopmentofmonokineamplifiedifngreleaseassays AT mitchellj migrasaretheythenewigrasdevelopmentofmonokineamplifiedifngreleaseassays AT klenermanp migrasaretheythenewigrasdevelopmentofmonokineamplifiedifngreleaseassays |