Photoinduced, family-specific, site-selective cleavage of TIM-barrel proteins.
Nonenzymatic, chemical methods for the controlled cleavage of proteins at predictable sites in a site-specific manner are rare and of strong potential utility in clean, post-translational manipulation of protein structure for use in, for example, proteomics, sequencing, and tagged-protein production...
Main Authors: | , , , , , , |
---|---|
Format: | Journal article |
Language: | English |
Published: |
2009
|
_version_ | 1797074852998283264 |
---|---|
author | Floyd, N Oldham, N Eyles, C Taylor, S Filatov, D Brouard, M Davis, B |
author_facet | Floyd, N Oldham, N Eyles, C Taylor, S Filatov, D Brouard, M Davis, B |
author_sort | Floyd, N |
collection | OXFORD |
description | Nonenzymatic, chemical methods for the controlled cleavage of proteins at predictable sites in a site-specific manner are rare and of strong potential utility in clean, post-translational manipulation of protein structure for use in, for example, proteomics, sequencing, and tagged-protein production. Unprecedented photochemical, site-selective cleavage of a His-Trp (HW) motif in the GH1 family TIM-barrel proteins is observed upon exposure to 240-308 nm light to cleanly release N-terminal primary amide and C-terminal indolylenamide fragments. We also show that this photocleaveable motif can be transferred to fusion proteins for use in photoresponsive affinty purification. The presence of this motif in proteins found only in organisms that are not typically exposed to light raises the possibility of direct biological relevance for this new type of protein reaction. |
first_indexed | 2024-03-06T23:42:13Z |
format | Journal article |
id | oxford-uuid:6fb6cb68-1d71-4e2f-9dd3-2a4734fa98da |
institution | University of Oxford |
language | English |
last_indexed | 2024-03-06T23:42:13Z |
publishDate | 2009 |
record_format | dspace |
spelling | oxford-uuid:6fb6cb68-1d71-4e2f-9dd3-2a4734fa98da2022-03-26T19:32:23ZPhotoinduced, family-specific, site-selective cleavage of TIM-barrel proteins.Journal articlehttp://purl.org/coar/resource_type/c_dcae04bcuuid:6fb6cb68-1d71-4e2f-9dd3-2a4734fa98daEnglishSymplectic Elements at Oxford2009Floyd, NOldham, NEyles, CTaylor, SFilatov, DBrouard, MDavis, BNonenzymatic, chemical methods for the controlled cleavage of proteins at predictable sites in a site-specific manner are rare and of strong potential utility in clean, post-translational manipulation of protein structure for use in, for example, proteomics, sequencing, and tagged-protein production. Unprecedented photochemical, site-selective cleavage of a His-Trp (HW) motif in the GH1 family TIM-barrel proteins is observed upon exposure to 240-308 nm light to cleanly release N-terminal primary amide and C-terminal indolylenamide fragments. We also show that this photocleaveable motif can be transferred to fusion proteins for use in photoresponsive affinty purification. The presence of this motif in proteins found only in organisms that are not typically exposed to light raises the possibility of direct biological relevance for this new type of protein reaction. |
spellingShingle | Floyd, N Oldham, N Eyles, C Taylor, S Filatov, D Brouard, M Davis, B Photoinduced, family-specific, site-selective cleavage of TIM-barrel proteins. |
title | Photoinduced, family-specific, site-selective cleavage of TIM-barrel proteins. |
title_full | Photoinduced, family-specific, site-selective cleavage of TIM-barrel proteins. |
title_fullStr | Photoinduced, family-specific, site-selective cleavage of TIM-barrel proteins. |
title_full_unstemmed | Photoinduced, family-specific, site-selective cleavage of TIM-barrel proteins. |
title_short | Photoinduced, family-specific, site-selective cleavage of TIM-barrel proteins. |
title_sort | photoinduced family specific site selective cleavage of tim barrel proteins |
work_keys_str_mv | AT floydn photoinducedfamilyspecificsiteselectivecleavageoftimbarrelproteins AT oldhamn photoinducedfamilyspecificsiteselectivecleavageoftimbarrelproteins AT eylesc photoinducedfamilyspecificsiteselectivecleavageoftimbarrelproteins AT taylors photoinducedfamilyspecificsiteselectivecleavageoftimbarrelproteins AT filatovd photoinducedfamilyspecificsiteselectivecleavageoftimbarrelproteins AT brouardm photoinducedfamilyspecificsiteselectivecleavageoftimbarrelproteins AT davisb photoinducedfamilyspecificsiteselectivecleavageoftimbarrelproteins |