The agrin/muscle-specific kinase pathway: new targets for autoimmune and genetic disorders at the neuromuscular junction.
The increasing understanding of the structural complexity of the neuromuscular junction (NMJ), and the processes that are important in its development, suggests many possible new disease targets. Here, we summarize briefly the genetic and autoimmune disorders that affect neuromuscular transmission,...
| Main Authors: | , , , |
|---|---|
| Format: | Journal article |
| Language: | English |
| Published: |
2002
|
| _version_ | 1797087515987935232 |
|---|---|
| author | Liyanage, Y Hoch, W Beeson, D Vincent, A |
| author_facet | Liyanage, Y Hoch, W Beeson, D Vincent, A |
| author_sort | Liyanage, Y |
| collection | OXFORD |
| description | The increasing understanding of the structural complexity of the neuromuscular junction (NMJ), and the processes that are important in its development, suggests many possible new disease targets. Here, we summarize briefly the genetic and autoimmune disorders that affect neuromuscular transmission, and the identified targets, including new evidence that antibodies to muscle-specific receptor tyrosine kinase (MuSK) are involved in the pathogenesis of acetylcholine receptor (AChR) antibody-negative myasthenia gravis. We then review the development of the NMJ, focusing on the important roles of nerve-derived agrin and MuSK in clustering of AChRs and other essential components of the NMJ. |
| first_indexed | 2024-03-07T02:36:46Z |
| format | Journal article |
| id | oxford-uuid:a90a378b-c0cc-4646-ab53-7b278aad274c |
| institution | University of Oxford |
| language | English |
| last_indexed | 2024-03-07T02:36:46Z |
| publishDate | 2002 |
| record_format | dspace |
| spelling | oxford-uuid:a90a378b-c0cc-4646-ab53-7b278aad274c2022-03-27T03:05:45ZThe agrin/muscle-specific kinase pathway: new targets for autoimmune and genetic disorders at the neuromuscular junction.Journal articlehttp://purl.org/coar/resource_type/c_dcae04bcuuid:a90a378b-c0cc-4646-ab53-7b278aad274cEnglishSymplectic Elements at Oxford2002Liyanage, YHoch, WBeeson, DVincent, AThe increasing understanding of the structural complexity of the neuromuscular junction (NMJ), and the processes that are important in its development, suggests many possible new disease targets. Here, we summarize briefly the genetic and autoimmune disorders that affect neuromuscular transmission, and the identified targets, including new evidence that antibodies to muscle-specific receptor tyrosine kinase (MuSK) are involved in the pathogenesis of acetylcholine receptor (AChR) antibody-negative myasthenia gravis. We then review the development of the NMJ, focusing on the important roles of nerve-derived agrin and MuSK in clustering of AChRs and other essential components of the NMJ. |
| spellingShingle | Liyanage, Y Hoch, W Beeson, D Vincent, A The agrin/muscle-specific kinase pathway: new targets for autoimmune and genetic disorders at the neuromuscular junction. |
| title | The agrin/muscle-specific kinase pathway: new targets for autoimmune and genetic disorders at the neuromuscular junction. |
| title_full | The agrin/muscle-specific kinase pathway: new targets for autoimmune and genetic disorders at the neuromuscular junction. |
| title_fullStr | The agrin/muscle-specific kinase pathway: new targets for autoimmune and genetic disorders at the neuromuscular junction. |
| title_full_unstemmed | The agrin/muscle-specific kinase pathway: new targets for autoimmune and genetic disorders at the neuromuscular junction. |
| title_short | The agrin/muscle-specific kinase pathway: new targets for autoimmune and genetic disorders at the neuromuscular junction. |
| title_sort | agrin muscle specific kinase pathway new targets for autoimmune and genetic disorders at the neuromuscular junction |
| work_keys_str_mv | AT liyanagey theagrinmusclespecifickinasepathwaynewtargetsforautoimmuneandgeneticdisordersattheneuromuscularjunction AT hochw theagrinmusclespecifickinasepathwaynewtargetsforautoimmuneandgeneticdisordersattheneuromuscularjunction AT beesond theagrinmusclespecifickinasepathwaynewtargetsforautoimmuneandgeneticdisordersattheneuromuscularjunction AT vincenta theagrinmusclespecifickinasepathwaynewtargetsforautoimmuneandgeneticdisordersattheneuromuscularjunction AT liyanagey agrinmusclespecifickinasepathwaynewtargetsforautoimmuneandgeneticdisordersattheneuromuscularjunction AT hochw agrinmusclespecifickinasepathwaynewtargetsforautoimmuneandgeneticdisordersattheneuromuscularjunction AT beesond agrinmusclespecifickinasepathwaynewtargetsforautoimmuneandgeneticdisordersattheneuromuscularjunction AT vincenta agrinmusclespecifickinasepathwaynewtargetsforautoimmuneandgeneticdisordersattheneuromuscularjunction |