CD4 T cells from malaria-nonexposed individuals respond to the CD36-Binding Domain of Plasmodium falciparum erythrocyte membrane protein-1 via an MHC class II-TCR-independent pathway.
We have studied the human CD4 T cell response to a functionally conserved domain of Plasmodium falciparum erythrocyte membrane protein-1, cysteine interdomain region-1alpha (CIDR-1alpha). Responses to CIDR-1alpha were striking in that both exposed and nonexposed donors responded. The IFN-gamma respo...
| Principais autores: | , , , , , , |
|---|---|
| Formato: | Journal article |
| Idioma: | English |
| Publicado em: |
2006
|
| _version_ | 1826299909195694080 |
|---|---|
| author | Ndungu, F Sanni, L Urban, B Stephens, R Newbold, C Marsh, K Langhorne, J |
| author_facet | Ndungu, F Sanni, L Urban, B Stephens, R Newbold, C Marsh, K Langhorne, J |
| author_sort | Ndungu, F |
| collection | OXFORD |
| description | We have studied the human CD4 T cell response to a functionally conserved domain of Plasmodium falciparum erythrocyte membrane protein-1, cysteine interdomain region-1alpha (CIDR-1alpha). Responses to CIDR-1alpha were striking in that both exposed and nonexposed donors responded. The IFN-gamma response to CIDR-1alpha in the nonexposed donors was partially independent of TCR engagement of MHC class II and peptide. Contrastingly, CD4 T cell and IFN-gamma responses in malaria-exposed donors were MHC class II restricted, suggesting that the CD4 T cell response to CIDR-1alpha in malaria semi-immune adults also has a TCR-mediated component, which may represent a memory response. Dendritic cells isolated from human peripheral blood were activated by CIDR-1alpha to produce IL-12, IL-10, and IL-18. IL-12 was detectable only between 6 and 12 h of culture, whereas the IL-10 continued to increase throughout the 24-h time course. These data strengthen previous observations that P. falciparum interacts directly with human dendritic cells, and suggests that the interaction between CIDR-1alpha and the host cell may be responsible for regulation of the CD4 T cell and cytokine responses to P. falciparum-infected erythrocytes reported previously. |
| first_indexed | 2024-03-07T05:09:06Z |
| format | Journal article |
| id | oxford-uuid:daf32e2a-6022-4c6c-a9bd-4ac85fe6e134 |
| institution | University of Oxford |
| language | English |
| last_indexed | 2024-03-07T05:09:06Z |
| publishDate | 2006 |
| record_format | dspace |
| spelling | oxford-uuid:daf32e2a-6022-4c6c-a9bd-4ac85fe6e1342022-03-27T09:06:50ZCD4 T cells from malaria-nonexposed individuals respond to the CD36-Binding Domain of Plasmodium falciparum erythrocyte membrane protein-1 via an MHC class II-TCR-independent pathway.Journal articlehttp://purl.org/coar/resource_type/c_dcae04bcuuid:daf32e2a-6022-4c6c-a9bd-4ac85fe6e134EnglishSymplectic Elements at Oxford2006Ndungu, FSanni, LUrban, BStephens, RNewbold, CMarsh, KLanghorne, JWe have studied the human CD4 T cell response to a functionally conserved domain of Plasmodium falciparum erythrocyte membrane protein-1, cysteine interdomain region-1alpha (CIDR-1alpha). Responses to CIDR-1alpha were striking in that both exposed and nonexposed donors responded. The IFN-gamma response to CIDR-1alpha in the nonexposed donors was partially independent of TCR engagement of MHC class II and peptide. Contrastingly, CD4 T cell and IFN-gamma responses in malaria-exposed donors were MHC class II restricted, suggesting that the CD4 T cell response to CIDR-1alpha in malaria semi-immune adults also has a TCR-mediated component, which may represent a memory response. Dendritic cells isolated from human peripheral blood were activated by CIDR-1alpha to produce IL-12, IL-10, and IL-18. IL-12 was detectable only between 6 and 12 h of culture, whereas the IL-10 continued to increase throughout the 24-h time course. These data strengthen previous observations that P. falciparum interacts directly with human dendritic cells, and suggests that the interaction between CIDR-1alpha and the host cell may be responsible for regulation of the CD4 T cell and cytokine responses to P. falciparum-infected erythrocytes reported previously. |
| spellingShingle | Ndungu, F Sanni, L Urban, B Stephens, R Newbold, C Marsh, K Langhorne, J CD4 T cells from malaria-nonexposed individuals respond to the CD36-Binding Domain of Plasmodium falciparum erythrocyte membrane protein-1 via an MHC class II-TCR-independent pathway. |
| title | CD4 T cells from malaria-nonexposed individuals respond to the CD36-Binding Domain of Plasmodium falciparum erythrocyte membrane protein-1 via an MHC class II-TCR-independent pathway. |
| title_full | CD4 T cells from malaria-nonexposed individuals respond to the CD36-Binding Domain of Plasmodium falciparum erythrocyte membrane protein-1 via an MHC class II-TCR-independent pathway. |
| title_fullStr | CD4 T cells from malaria-nonexposed individuals respond to the CD36-Binding Domain of Plasmodium falciparum erythrocyte membrane protein-1 via an MHC class II-TCR-independent pathway. |
| title_full_unstemmed | CD4 T cells from malaria-nonexposed individuals respond to the CD36-Binding Domain of Plasmodium falciparum erythrocyte membrane protein-1 via an MHC class II-TCR-independent pathway. |
| title_short | CD4 T cells from malaria-nonexposed individuals respond to the CD36-Binding Domain of Plasmodium falciparum erythrocyte membrane protein-1 via an MHC class II-TCR-independent pathway. |
| title_sort | cd4 t cells from malaria nonexposed individuals respond to the cd36 binding domain of plasmodium falciparum erythrocyte membrane protein 1 via an mhc class ii tcr independent pathway |
| work_keys_str_mv | AT ndunguf cd4tcellsfrommalarianonexposedindividualsrespondtothecd36bindingdomainofplasmodiumfalciparumerythrocytemembraneprotein1viaanmhcclassiitcrindependentpathway AT sannil cd4tcellsfrommalarianonexposedindividualsrespondtothecd36bindingdomainofplasmodiumfalciparumerythrocytemembraneprotein1viaanmhcclassiitcrindependentpathway AT urbanb cd4tcellsfrommalarianonexposedindividualsrespondtothecd36bindingdomainofplasmodiumfalciparumerythrocytemembraneprotein1viaanmhcclassiitcrindependentpathway AT stephensr cd4tcellsfrommalarianonexposedindividualsrespondtothecd36bindingdomainofplasmodiumfalciparumerythrocytemembraneprotein1viaanmhcclassiitcrindependentpathway AT newboldc cd4tcellsfrommalarianonexposedindividualsrespondtothecd36bindingdomainofplasmodiumfalciparumerythrocytemembraneprotein1viaanmhcclassiitcrindependentpathway AT marshk cd4tcellsfrommalarianonexposedindividualsrespondtothecd36bindingdomainofplasmodiumfalciparumerythrocytemembraneprotein1viaanmhcclassiitcrindependentpathway AT langhornej cd4tcellsfrommalarianonexposedindividualsrespondtothecd36bindingdomainofplasmodiumfalciparumerythrocytemembraneprotein1viaanmhcclassiitcrindependentpathway |