Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapor deposition
Single-walled carbon nanotubes (SWCNTs) were synthesized by catalytic chemical vapor deposition (CCVD) of ethanol (C2H5OH) over Fe-Mo-MgO catalyst by using argon as a carrier gas. The reaction conditions are important factors that influence the yield and quality of carbon nanotubes. The effects of t...
Main Authors: | , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Universiti Kebangsaan Malaysia
2011
|
Online Access: | http://journalarticle.ukm.my/697/1/01_Setareh.pdf |
_version_ | 1796914283022385152 |
---|---|
author | Setareh Monshi Toussi, A. Fakhru’l-Razi, A. Luqman Chuah, A.R. Suraya, |
author_facet | Setareh Monshi Toussi, A. Fakhru’l-Razi, A. Luqman Chuah, A.R. Suraya, |
author_sort | Setareh Monshi Toussi, |
collection | UKM |
description | Single-walled carbon nanotubes (SWCNTs) were synthesized by catalytic chemical vapor deposition (CCVD) of ethanol (C2H5OH) over Fe-Mo-MgO catalyst by using argon as a carrier gas. The reaction conditions are important factors that influence the yield and quality of carbon nanotubes. The effects of temperature and flow rate of carrier gas were investigated to increase the yield of carbon nanotubes. The synthesized carbon nanotubes were characterized by scanning electron microscopy, transmission electron microscopy, X-Ray diffraction and thermo-gravimetric analysis. The results showed that the growth of carbon nanotubes wass effectively influenced by the reaction ambience and the synthesis condition. The temperature and flow rate of carrier gas played a key role in the yield and quality of synthesized CNTs. The estimated yield of synthesized carbon nanotubes was almost over 70%. |
first_indexed | 2024-03-06T03:40:23Z |
format | Article |
id | ukm.eprints-697 |
institution | Universiti Kebangsaan Malaysia |
language | English |
last_indexed | 2024-03-06T03:40:23Z |
publishDate | 2011 |
publisher | Universiti Kebangsaan Malaysia |
record_format | dspace |
spelling | ukm.eprints-6972016-12-14T06:27:55Z http://journalarticle.ukm.my/697/ Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapor deposition Setareh Monshi Toussi, A. Fakhru’l-Razi, A. Luqman Chuah, A.R. Suraya, Single-walled carbon nanotubes (SWCNTs) were synthesized by catalytic chemical vapor deposition (CCVD) of ethanol (C2H5OH) over Fe-Mo-MgO catalyst by using argon as a carrier gas. The reaction conditions are important factors that influence the yield and quality of carbon nanotubes. The effects of temperature and flow rate of carrier gas were investigated to increase the yield of carbon nanotubes. The synthesized carbon nanotubes were characterized by scanning electron microscopy, transmission electron microscopy, X-Ray diffraction and thermo-gravimetric analysis. The results showed that the growth of carbon nanotubes wass effectively influenced by the reaction ambience and the synthesis condition. The temperature and flow rate of carrier gas played a key role in the yield and quality of synthesized CNTs. The estimated yield of synthesized carbon nanotubes was almost over 70%. Universiti Kebangsaan Malaysia 2011-03 Article PeerReviewed application/pdf en http://journalarticle.ukm.my/697/1/01_Setareh.pdf Setareh Monshi Toussi, and A. Fakhru’l-Razi, and A. Luqman Chuah, and A.R. Suraya, (2011) Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapor deposition. Sains Malaysiana, 40 (3). pp. 197-201. ISSN 0126-6039 |
spellingShingle | Setareh Monshi Toussi, A. Fakhru’l-Razi, A. Luqman Chuah, A.R. Suraya, Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapor deposition |
title | Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapor deposition |
title_full | Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapor deposition |
title_fullStr | Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapor deposition |
title_full_unstemmed | Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapor deposition |
title_short | Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapor deposition |
title_sort | effect of synthesis condition on the growth of swcnts via catalytic chemical vapor deposition |
url | http://journalarticle.ukm.my/697/1/01_Setareh.pdf |
work_keys_str_mv | AT setarehmonshitoussi effectofsynthesisconditiononthegrowthofswcntsviacatalyticchemicalvapordeposition AT afakhrulrazi effectofsynthesisconditiononthegrowthofswcntsviacatalyticchemicalvapordeposition AT aluqmanchuah effectofsynthesisconditiononthegrowthofswcntsviacatalyticchemicalvapordeposition AT arsuraya effectofsynthesisconditiononthegrowthofswcntsviacatalyticchemicalvapordeposition |