Molecular survey and sequence analysis of Anaplasma spp. in cattle and ticks in a Malaysian farm
This study was conducted to determine the occurrence of Anaplasma spp. in the blood samples of cattle, goats, deer and ticks in a Malaysian farm. Using polymerase chain reaction (PCR) and sequencing approach, Anaplasma spp. was detected from 81(84.4%) of 96 cattle blood samples. All blood samples fr...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Published: |
Malaysian Society of Parasitology and Tropical Medicine
2014
|
| Subjects: |
| _version_ | 1825720680493088768 |
|---|---|
| author | Tay, S.T. Koh, F.X. Kho, K.L. Ong, B.L. |
| author_facet | Tay, S.T. Koh, F.X. Kho, K.L. Ong, B.L. |
| author_sort | Tay, S.T. |
| collection | UM |
| description | This study was conducted to determine the occurrence of Anaplasma spp. in the blood samples of cattle, goats, deer and ticks in a Malaysian farm. Using polymerase chain reaction (PCR) and sequencing approach, Anaplasma spp. was detected from 81(84.4%) of 96 cattle blood samples. All blood samples from 23 goats and 22 deer tested were negative. Based on the analysis of the Anaplasma partial 16S ribosomal RNA gene, four sequence types (genotypes 1 to 4) were identified in this study. Genotypes 1-3 showed high sequence similarity to those of Anaplasma platys/Anaplasma phagocytophilum, whilst genotype 4 was identical to those of Anaplasma marginale/Anaplasma centrale/Anaplasma ovis. Anaplasma DNA was detected from six (5.5%) of 109 ticks which were identified as Rhipicephalus (formely known as Boophilus) microplus ticks collected from the cattle. This study reported for the first time the detection of four Anaplasma sequence types circulating in the cattle population in a farm in Malaysia. The detection of Anaplasma DNA in R. microplus ticks in this study provides evidence that the ticks are one of the potential vectors for transmission of anaplasmosis in the cattle. |
| first_indexed | 2024-03-06T05:38:48Z |
| format | Article |
| id | um.eprints-15441 |
| institution | Universiti Malaya |
| last_indexed | 2024-03-06T05:38:48Z |
| publishDate | 2014 |
| publisher | Malaysian Society of Parasitology and Tropical Medicine |
| record_format | dspace |
| spelling | um.eprints-154412019-02-13T09:11:05Z http://eprints.um.edu.my/15441/ Molecular survey and sequence analysis of Anaplasma spp. in cattle and ticks in a Malaysian farm Tay, S.T. Koh, F.X. Kho, K.L. Ong, B.L. Q Science (General) This study was conducted to determine the occurrence of Anaplasma spp. in the blood samples of cattle, goats, deer and ticks in a Malaysian farm. Using polymerase chain reaction (PCR) and sequencing approach, Anaplasma spp. was detected from 81(84.4%) of 96 cattle blood samples. All blood samples from 23 goats and 22 deer tested were negative. Based on the analysis of the Anaplasma partial 16S ribosomal RNA gene, four sequence types (genotypes 1 to 4) were identified in this study. Genotypes 1-3 showed high sequence similarity to those of Anaplasma platys/Anaplasma phagocytophilum, whilst genotype 4 was identical to those of Anaplasma marginale/Anaplasma centrale/Anaplasma ovis. Anaplasma DNA was detected from six (5.5%) of 109 ticks which were identified as Rhipicephalus (formely known as Boophilus) microplus ticks collected from the cattle. This study reported for the first time the detection of four Anaplasma sequence types circulating in the cattle population in a farm in Malaysia. The detection of Anaplasma DNA in R. microplus ticks in this study provides evidence that the ticks are one of the potential vectors for transmission of anaplasmosis in the cattle. Malaysian Society of Parasitology and Tropical Medicine 2014 Article PeerReviewed Tay, S.T. and Koh, F.X. and Kho, K.L. and Ong, B.L. (2014) Molecular survey and sequence analysis of Anaplasma spp. in cattle and ticks in a Malaysian farm. Tropical Biomedicine, 31 (4). pp. 769-776. ISSN 0127-5720, |
| spellingShingle | Q Science (General) Tay, S.T. Koh, F.X. Kho, K.L. Ong, B.L. Molecular survey and sequence analysis of Anaplasma spp. in cattle and ticks in a Malaysian farm |
| title | Molecular survey and sequence analysis of Anaplasma spp. in cattle and ticks in a Malaysian farm |
| title_full | Molecular survey and sequence analysis of Anaplasma spp. in cattle and ticks in a Malaysian farm |
| title_fullStr | Molecular survey and sequence analysis of Anaplasma spp. in cattle and ticks in a Malaysian farm |
| title_full_unstemmed | Molecular survey and sequence analysis of Anaplasma spp. in cattle and ticks in a Malaysian farm |
| title_short | Molecular survey and sequence analysis of Anaplasma spp. in cattle and ticks in a Malaysian farm |
| title_sort | molecular survey and sequence analysis of anaplasma spp in cattle and ticks in a malaysian farm |
| topic | Q Science (General) |
| work_keys_str_mv | AT tayst molecularsurveyandsequenceanalysisofanaplasmasppincattleandticksinamalaysianfarm AT kohfx molecularsurveyandsequenceanalysisofanaplasmasppincattleandticksinamalaysianfarm AT khokl molecularsurveyandsequenceanalysisofanaplasmasppincattleandticksinamalaysianfarm AT ongbl molecularsurveyandsequenceanalysisofanaplasmasppincattleandticksinamalaysianfarm |